DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYPN and Strn-Mlck

DIOPT Version :10

Sequence 1:XP_016872322.1 Gene:MYPN / 84665 HGNCID:23246 Length:1346 Species:Homo sapiens
Sequence 2:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster


Alignment Length:1664 Identity:352/1664 - (21%)
Similarity:566/1664 - (34%) Gaps:508/1664 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     5 QVKTSSAIELPDSLAFLWIIPIMQDDSIEASTSISQLLRESYLAETRHRGNNERSRAEPSSNPCH 69
            :.:.|..:||.||               ||.:..:::|.:....:.:...|:::.:.:.::|   
  Fly  5133 KAEESQKVELKDS---------------EAKSKKAKVLEKKSTLKEKLDENDKKQKEDGATN--- 5179

Human    70 FGSPSGAAEGGGGQDDLPDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKR---LSPDQM 131
               .|..||..   |.:|:.   :|:|::.|       ....:|:    :::|:.:   |..|:.
  Fly  5180 ---KSQKAEAA---DVVPEK---ISEEKVAE-------IKTPEPM----DSKAKSKPDGLPADEK 5224

Human   132 KHSPNLSFEPNFCQDNPRSPTSSKESPQEAKRPQYCSE---TQSKKVFL-NKAADFIEELSSLFK 192
            .|...:|      :..|....:.|.....||:|....|   ...:|.:| .:.||.|.  ...:|
  Fly  5225 SHGAKVS------ESVPVKNEAEKTDQLSAKKPTVLDEDLVVPKRKPYLAEQTADSIS--LQTYK 5281

Human   193 SHSSKRIRPRACKNHKSKLESQNKVMQENSSSFSDL-----------SERRERSSVPIPIPADTR 246
            |..|:....:..::.|.|.....::...|::|.|||           :.:..:.:.||...|..|
  Fly  5282 SMDSEYKDRKESRSAKRKPTVDIQLTNRNTASGSDLKLTCGLSGHEMNVQWFKDNCPIENGAKYR 5346

Human   247 DNEVNHALEQQEAKRREAEQAASEAAGGDTTPGSSPSS---LYYEEP---LGQPPRFTQKLRSRE 305
             ..:|..|...|.|..|...:...........|...:|   ..||.|   .|.||.||:.:|...
  Fly  5347 -RTLNDGLSCLEIKSAELGDSGIYRCIASNQNGEVETSCLVTIYEAPSSKFGTPPIFTRNIRDAY 5410

Human   306 VPEGTRVQLDCIVVGIPPPQVRWYCEGK--ELENSPDIHIVQAGNLHSLTIAEAFEEDTGRYSCF 368
            ..:|.::.|:|.|.|.|.|.:.|..:..  .:|.:...:..|:..:..|||......|:|.|:|:
  Fly  5411 HSQGNQLTLECKVSGSPKPHIYWQRDNTLLPIEGTKYQYEEQSDGIKLLTINNFGSNDSGLYTCY 5475

Human   369 ASNIYGTDSTSAEIYIEGVSSSD------SEGDPNKEEMNRIQKPNEVSSPPTTSAVIPPAVPQA 427
            |.:..|....|     :.|.:||      ::..|..:.:..|::....|:....:|.......:|
  Fly  5476 AESENGQMKIS-----KFVQASDYVRERIADKKPIDKVIQEIKRDESSSAAANDTAAAKAKAREA 5535

Human   428 Q---HLVAQPRVATIQQ-------CQSPTNYLQGL---------------DGK-------PIIAA 460
            :   :|....:..||..       |     |:.|:               |.:       ..|:.
  Fly  5536 KLRLNLETSLKTMTIGSGNKAQLIC-----YVTGIIEDVHWLRNDERVTKDARHKIYNINGAISL 5595

Human   461 PVFTKMLQN-----------------------LSASEGQL------------------VVFECRV 484
            .::...:::                       |..|.|:|                  :|..|:|
  Fly  5596 EIYDARVEDSGHYRCVVKNSRQTVESAGQLSVLDQSTGKLPESFSSGIIESYDDQRNEIVLSCQV 5660

Human   485 KGAPSPKVEWYREGTLIEDSPDFRILQKKPRSMAEPEEICTLVIAEVFAEDSGCFTCTASNK--- 546
            .|.||  |.|.|:        |..|...:.|::.||..:..|||....:.|.|.|.|.|.::   
  Fly  5661 IGRPS--VSWMRD--------DHSICNNRYRTIEEPGGVRKLVIRNPISSDCGIFACYAEHEDRI 5715

Human   547 -----------------------------YGTVSSIAQLHVRGNEDLSNNGSLHSA--------- 573
                                         ..|..|.:|.|:.....::.||.||.|         
  Fly  5716 DSTSITIKAADLKRLINVSQEEIPSIGDHESTPWSRSQSHLSSGSQVNGNGELHRAGDRVLRNVG 5780

Human   574 ---------------NSTTNLAAIEPQPSPPHSEPPSVEQPPKPKLEGVLVNHNE-PRSSSR--- 619
                           :...||..:           .||.......:|. |.||.. |||.:|   
  Fly  5781 KGKPLFHTLLHDRTVSEGANLRLV-----------CSVSGDENTHIEW-LKNHKPLPRSDNRYQT 5833

Human   620 ------IGLRVHFNLPEDDKGSE---ASSEAG-VVTTRQTR----------PDSFQE-------- 656
                  ..|.: |....||.|:.   |:::.| .:|..|.|          |.:|.:        
  Fly  5834 VYLNGEASLEI-FAAVADDSGNYTCCATNDFGESLTHAQLRVYKNFKEAPLPSTFTQPIRDTYSL 5897

Human   657 ---------RFNGQATKTPEPSSP-VKEPPPVLAKPKL-DSTQLQQLHNQVLLEQHQLQNPPPSS 710
                     |..||    |.|... :|...|:.|..|. .|.|.......|::.        |:.
  Fly  5898 NENELVLDCRVRGQ----PRPEIQWIKGTEPIEASEKFKPSDQADGYAKLVIVN--------PTE 5950

Human   711 PKEFPFSMTVLNSNAPPAVTTSSKQVKAPSSQTFSLA-----------RPKYFFPSTNTT---AA 761
            .....:.....|..|...:   |.||.....|.:||.           :|.:..|..|.|   ..
  Fly  5951 KDSGIYWCVARNEGAENKI---SHQVDFKGRQHYSLEKTHGFFHRDPNKPHFLLPLGNQTVCNGG 6012

Human   762 TVAPSSSPVFTLSSTPQTIQRTVSKESLLVSHPSVQTKSPGG---LSIQNEPLPPGP-------- 815
            |||.|:.  |..:|||  |:....::..:|..|:|:..:..|   |:|.|    .||        
  Fly  6013 TVAISAE--FMETSTP--IEVKWLRDRRVVDGPNVKALADRGVYTLTIMN----AGPEVEGTYTC 6069

Human   816 ----------------------TEPTPP----------------PFTFSI--------------- 827
                                  .:..||                ||:.|.               
  Fly  6070 RASNAFGRIESNVNVDVAVGAEKDERPPLFLSRPDTEMKIAVGDPFSLSFRIAGDPKPKLTFMKG 6134

Human   828 -----------------------------PSGNQF------------------QPRCVSPIPVSP 845
                                         .||..|                  .||..|..|..|
  Fly  6135 TKDITQSDRVSKEVSDDYTRFSVQQAQISDSGTYFVVARNNFGTDRIFVTVTVNPRARSATPTQP 6199

Human   846 -----------TSRIQNPVAFLSSVLPSLPAIPPTN---AMGLPRSAPSMPSQGLAKKNTKSPQP 896
                       ||..::|...:|:. |.:....||:   :.|.|.||.|.|.  :|.|       
  Fly  6200 RWGLPLDSYSDTSYFRDPPGCISTE-PLVVDSGPTHISLSWGKPVSANSAPV--MAYK------- 6254

Human   897 VNDDNIRETKNAVIRDLGKKITFSDVRPNQQEYKISSFEQ-RLMNEIEFRLERTPVD-------- 952
            |....:.....|..|:||       :.|      |:||:. .|...:|:....||.:        
  Fly  6255 VEAWVVGHEGGAYWRELG-------LTP------INSFDAFNLKPNVEYHFRVTPKNRYGWGPTV 6306

Human   953 ESDDEIQHDEIPTGKCIAPIFDKRLK-HFRVTEGSPVTFTCKIVGIPVPKVYWFKDGKQISKRNE 1016
            ::...:|...:   :|: |.|.|.|. ..:...||..|..|.:.|.|.|:|.|||||.|:|..:|
  Fly  6307 QTSSPLQVGGV---ECL-PEFVKILPGQAKALLGSSFTLQCNMRGAPRPQVTWFKDGIQLSSSSE 6367

Human  1017 HCKMRREGDGTCSLHIESTTSDDDGNYTIMAANPQGRISCSGHLMVQSLPIRSRLTSAGQ----- 1076
            ..|:|:.| .||:|.|.:.:..|.|.||..|.|.:||:|....|.|.|   .||:..|..     
  Fly  6368 RVKIRQIG-STCALTIATVSELDSGRYTCEATNSKGRVSTFARLQVVS---DSRIYEADSRLKEI 6428

Human  1077 SHRGRSRVQERDKEPLQERFFRPHFLQAPGDMVAHEGRLCRLDCKVSGLPPPELTWLLNGQPVLP 1141
            :| ||:.....|..|:.....|...:|....:        ||.|::.|.|.||:.|..:.:.:..
  Fly  6429 AH-GRNVADVGDSLPIFTMRLRDRRVQVTYPV--------RLTCQIVGYPVPEILWYKDDELIHT 6484

Human  1142 DASHKMLVRETGVHSLLIDPLTQRDAGTYKCIATNKTGQNSFSLELSVVAKEVKK--APVILEKL 1204
            |..| ::..|....:|.|...|..|:|||.|:|.|:.|..|....| ||.|.::.  :|.....|
  Fly  6485 DRKH-LISAEGQFFTLEIAATTLDDSGTYTCLARNELGSVSCHCTL-VVDKGIRAYISPDFYVPL 6547

Human  1205 QNCGV-PEGHPVRLECRVIGMPPPVFYWKKDNETIPCTRERISMHQDTTGYACLLIQPAKKSDAG 1268
            ....: .||..:||..:|...|.....|.::...:..:| |::...|:.||..|:|..|...|||
  Fly  6548 DPFYIFREGSEIRLSTKVEAYPSVGVTWHRNGMRLRPSR-RLTATLDSNGYVELIIAEATVRDAG 6611

Human  1269 WYTLSAKNEAGIVSCTARLDIYAQWHHQIPPPMSVR-PS 1306
            .|...|.|..|.|....|:.:....:..:.|..|:. ||
  Fly  6612 IYVCVASNVVGKVETICRVAVEEAENKAVAPQRSLEIPS 6650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYPNXP_016872322.1 Ig 294..384 CDD:472250 25/91 (27%)
Ig strand B 312..316 CDD:409353 1/3 (33%)
Ig strand C 325..329 CDD:409353 0/3 (0%)
Ig strand E 350..354 CDD:409353 1/3 (33%)
Ig strand F 364..369 CDD:409353 2/4 (50%)
Ig strand G 377..380 CDD:409353 0/2 (0%)
I-set 461..558 CDD:400151 29/169 (17%)
Ig strand B 478..482 CDD:409353 1/3 (33%)
Ig strand C 491..495 CDD:409353 1/3 (33%)
Ig strand E 524..528 CDD:409353 1/3 (33%)
Ig strand F 538..543 CDD:409353 2/4 (50%)
Ig strand G 551..554 CDD:409353 1/2 (50%)
PHA03247 <597..883 CDD:223021 88/467 (19%)
Ig 971..1062 CDD:472250 37/91 (41%)
Ig strand B 988..992 CDD:409353 1/3 (33%)
Ig strand C 1001..1005 CDD:409353 1/3 (33%)
Ig strand E 1028..1032 CDD:409353 2/3 (67%)
Ig strand F 1042..1047 CDD:409353 2/4 (50%)
Ig strand G 1055..1058 CDD:409353 1/2 (50%)
Ig 1099..1189 CDD:472250 25/89 (28%)
Ig strand B 1116..1120 CDD:409353 2/3 (67%)
Ig strand C 1129..1133 CDD:409353 1/3 (33%)
Ig strand E 1155..1159 CDD:409353 1/3 (33%)
Ig strand F 1169..1174 CDD:409353 3/4 (75%)
Ig strand G 1182..1185 CDD:409353 1/2 (50%)
Ig 1198..1289 CDD:472250 26/91 (29%)
Ig strand B 1215..1219 CDD:409353 2/3 (67%)
Ig strand C 1228..1232 CDD:409353 0/3 (0%)
Ig strand E 1255..1259 CDD:409353 1/3 (33%)
Ig strand F 1269..1274 CDD:409353 1/4 (25%)
Ig strand G 1282..1285 CDD:409353 0/2 (0%)
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412
PTZ00121 <4215..5072 CDD:173412
I-set 5300..5388 CDD:400151 16/88 (18%)
Ig strand B 5317..5321 CDD:409353 1/3 (33%)
Ig strand C 5329..5333 CDD:409353 0/3 (0%)
Ig strand E 5354..5358 CDD:409353 0/3 (0%)
Ig strand F 5368..5373 CDD:409353 0/4 (0%)
Ig_3 5399..5477 CDD:464046 22/77 (29%)
Ig 5542..5627 CDD:472250 7/89 (8%)
Ig strand B 5556..5560 CDD:409353 0/3 (0%)
Ig strand C 5568..5572 CDD:409353 0/3 (0%)
Ig strand E 5593..5597 CDD:409353 1/3 (33%)
Ig strand F 5607..5612 CDD:409353 0/4 (0%)
Ig 5654..5721 CDD:409353 22/76 (29%)
Ig strand B 5654..5658 CDD:409353 1/3 (33%)
Ig strand C 5665..5669 CDD:409353 2/5 (40%)
Ig strand E 5690..5694 CDD:409353 1/3 (33%)
Ig strand F 5704..5709 CDD:409353 2/4 (50%)
Ig strand G 5718..5721 CDD:409353 0/2 (0%)
I-set 5784..5874 CDD:400151 21/102 (21%)
Ig strand B 5801..5805 CDD:409353 1/14 (7%)
Ig strand C 5814..5818 CDD:409353 1/4 (25%)
Ig strand E 5840..5844 CDD:409353 1/3 (33%)
Ig strand F 5854..5859 CDD:409353 0/4 (0%)
Ig 5902..5963 CDD:409353 13/72 (18%)
Ig strand B 5902..5906 CDD:409353 0/3 (0%)
Ig strand C 5915..5919 CDD:409353 0/3 (0%)
Ig strand E 5941..5945 CDD:409353 0/3 (0%)
Ig strand F 5955..5960 CDD:409353 0/4 (0%)
Ig 5997..6086 CDD:472250 22/96 (23%)
Ig strand B 6014..6018 CDD:409353 2/3 (67%)
Ig strand C 6028..6032 CDD:409353 0/3 (0%)
Ig strand E 6050..6056 CDD:409353 2/5 (40%)
Ig strand F 6066..6071 CDD:409353 0/4 (0%)
Ig strand G 6079..6082 CDD:409353 0/2 (0%)
Ig 6107..6187 CDD:472250 6/79 (8%)
Ig strand B 6115..6119 CDD:409353 1/3 (33%)
Ig strand C 6128..6132 CDD:409353 0/3 (0%)
Ig strand E 6153..6157 CDD:409353 0/3 (0%)
Ig strand F 6167..6172 CDD:409353 1/4 (25%)
Ig strand G 6180..6183 CDD:409353 0/2 (0%)
FN3 6216..6310 CDD:238020 26/116 (22%)
I-set 6321..6412 CDD:400151 37/91 (41%)
Ig strand B 6339..6343 CDD:409353 1/3 (33%)
Ig strand C 6352..6356 CDD:409353 1/3 (33%)
Ig strand E 6375..6382 CDD:409353 4/7 (57%)
Ig strand F 6392..6397 CDD:409353 2/4 (50%)
Ig strand G 6405..6408 CDD:409353 1/2 (50%)
I-set 6442..6531 CDD:400151 27/98 (28%)
Ig strand B 6459..6463 CDD:409353 2/11 (18%)
Ig strand C 6472..6476 CDD:409353 1/3 (33%)
Ig strand E 6497..6501 CDD:409353 1/3 (33%)
Ig strand F 6511..6516 CDD:409353 3/4 (75%)
Ig strand G 6524..6527 CDD:409353 1/2 (50%)
Ig 6541..6632 CDD:472250 26/91 (29%)
Ig strand B 6559..6563 CDD:409353 2/3 (67%)
Ig strand C 6572..6576 CDD:409353 0/3 (0%)
Ig strand E 6598..6602 CDD:409353 1/3 (33%)
Ig strand F 6612..6617 CDD:409353 1/4 (25%)
Ig strand G 6625..6628 CDD:409353 0/2 (0%)
Ig 6662..6754 CDD:472250
Ig strand B 6679..6683 CDD:409353
Ig strand C 6692..6696 CDD:409353
Ig strand E 6720..6724 CDD:409353
Ig strand F 6734..6739 CDD:409353
I-set 6779..6868 CDD:400151
Ig strand B 6796..6800 CDD:409353
Ig strand C 6809..6813 CDD:409353
Ig strand E 6834..6838 CDD:409353
Ig strand F 6848..6853 CDD:409353
I-set 6939..7028 CDD:400151
Ig strand B 6956..6960 CDD:409353
Ig strand C 6969..6973 CDD:409353
Ig strand E 6993..6998 CDD:409353
Ig strand F 7008..7013 CDD:409353
Ig strand G 7021..7024 CDD:409353
IG_like 7075..7140 CDD:214653
Ig strand C 7082..7086 CDD:409353
Ig strand E 7107..7111 CDD:409353
Ig strand F 7121..7126 CDD:409353
Ig strand G 7135..7138 CDD:409353
Ig 7173..7232 CDD:409353
Ig strand C 7184..7188 CDD:409353
Ig strand E 7210..7214 CDD:409353
Ig strand F 7224..7229 CDD:409353
IG_like 7406..7475 CDD:214653
Ig strand B 7413..7417 CDD:409353
Ig strand C 7426..7430 CDD:409353
Ig strand E 7451..7455 CDD:409353
Ig strand F 7465..7470 CDD:409353
FN3 7489..7588 CDD:238020
STKc_MLCK 7626..7876 CDD:271005
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.