DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLIS2 and ci

DIOPT Version :10

Sequence 1:NP_115964.2 Gene:GLIS2 / 84662 HGNCID:29450 Length:524 Species:Homo sapiens
Sequence 2:NP_524617.3 Gene:ci / 43767 FlyBaseID:FBgn0004859 Length:1397 Species:Drosophila melanogaster


Alignment Length:335 Identity:118/335 - (35%)
Similarity:167/335 - (49%) Gaps:56/335 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    27 TLGVVRPRALHRELG----LVDDSPTPGSPGS--PPSGFLLNSKFPEKVEGRFSAAPLVDLSLSP 85
            |...:|...:|..|.    .:..|||.....|  |.:.|.|.:    ..:.|....|..|:....
  Fly   310 TSASLRVNDVHPNLSDSHIQITTSPTVTKDVSQVPAAAFSLKN----LDDAREKKGPFKDVVPEQ 370

Human    86 PSG-------LDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLG---SGG 140
            ||.       :::.:.||.||.....|             .:..:.|:|...:....|.   :.|
  Fly   371 PSSTSGGVAQVEADSASSQLSDRCYNN-------------VVNNITGIPGDVKVNSRLDEYINCG 422

Human   141 ALHLPASSF------LTPPKDKCLSPDLPLPKQLV---CRWAKCNQLFELLQDLVDHVNDYHVKP 196
            ::.:|::.:      .|..||:        |...:   |.|..|...|....:||.|:|:.|::.
  Fly   423 SISIPSNEYDCANADTTDIKDE--------PGDFIETNCHWRSCRIEFITQDELVKHINNDHIQT 479

Human   197 EKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRC--PTCSKSFSRLENLKIHNRSHTG 259
            .|.| :.|.||.|.|..:.|.|:|.:::|:|.||.||||:|  ..|.|::|||||||.|.|||||
  Fly   480 NKKA-FVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTG 543

Human   260 EKPYVCPYEGCNKRYSNSSDRFKH-TRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIK-AHG-HFV 321
            ||||.|.|.||:|.:||:|||.|| .|||..:|||.||.|||.||||||||||||:| .|| .|.
  Fly   544 EKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKTVHGAEFY 608

Human   322 SHEQQELLQL 331
            ::::.:.|.|
  Fly   609 ANKKHKGLPL 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLIS2NP_115964.2 Interaction with CTNND1. /evidence=ECO:0000250 35..174 30/163 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..62 7/28 (25%)
Transcription activation. /evidence=ECO:0000250 71..137 12/72 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..114 7/36 (19%)
Transcription repression. /evidence=ECO:0000250 148..171 4/31 (13%)
C2H2 Zn finger 213..229 CDD:275368 5/15 (33%)
COG5048 233..>327 CDD:227381 62/98 (63%)
C2H2 Zn finger 237..257 CDD:275368 12/21 (57%)
C2H2 Zn finger 265..287 CDD:275368 13/22 (59%)
C2H2 Zn finger 295..317 CDD:275368 18/22 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..480
ciNP_524617.3 zf-H2C2_2 503..>521 CDD:463886 9/17 (53%)
SFP1 <513..603 CDD:227516 60/89 (67%)
C2H2 Zn finger 519..541 CDD:275368 12/21 (57%)
zf-H2C2_2 533..560 CDD:463886 18/26 (69%)
C2H2 Zn finger 549..572 CDD:275368 13/22 (59%)
C2H2 Zn finger 580..601 CDD:275368 17/20 (85%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.