| Sequence 1: | NP_115964.2 | Gene: | GLIS2 / 84662 | HGNCID: | 29450 | Length: | 524 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650728.1 | Gene: | CG7691 / 42228 | FlyBaseID: | FBgn0038626 | Length: | 283 | Species: | Drosophila melanogaster |
| Alignment Length: | 79 | Identity: | 30/79 - (37%) |
|---|---|---|---|
| Similarity: | 41/79 - (51%) | Gaps: | 5/79 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Human 237 CPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRT--HYVDKPYYCKMPG 299
Human 300 CHKRYTDPSSLRKH 313 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GLIS2 | NP_115964.2 | Interaction with CTNND1. /evidence=ECO:0000250 | 35..174 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 39..62 | ||||
| Transcription activation. /evidence=ECO:0000250 | 71..137 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 84..114 | ||||
| Transcription repression. /evidence=ECO:0000250 | 148..171 | ||||
| C2H2 Zn finger | 213..229 | CDD:275368 | |||
| COG5048 | 233..>327 | CDD:227381 | 30/79 (38%) | ||
| C2H2 Zn finger | 237..257 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 265..287 | CDD:275368 | 9/23 (39%) | ||
| C2H2 Zn finger | 295..317 | CDD:275368 | 6/19 (32%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 439..480 | ||||
| CG7691 | NP_650728.1 | COG5048 | 188..>271 | CDD:227381 | 30/79 (38%) |
| C2H2 Zn finger | 191..211 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 219..244 | CDD:275368 | 9/24 (38%) | ||
| C2H2 Zn finger | 250..266 | CDD:275368 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||