DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTBK1 and CG12147

DIOPT Version :9

Sequence 1:XP_016866853.1 Gene:TTBK1 / 84630 HGNCID:19140 Length:1409 Species:Homo sapiens
Sequence 2:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster


Alignment Length:439 Identity:136/439 - (30%)
Similarity:198/439 - (45%) Gaps:99/439 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     9 KDETNMSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQV 73
            ||:.......|:...|| ..:|..::::||:||.|.|||:::|..|...|.||:|:||:.....:
  Fly    44 KDQRQDRRFSEEKQSLP-EIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPL 107

Human    74 LKMEVAVLKKLQGK---DHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLG 135
            |..|..:...|||.   .||..:...|   .:|.:||.|.|..|.||.....| :|::.|||.|.
  Fly   108 LPREARIYGILQGGLGIPHVKHYATEG---AYNVMVMDLLGPTLEDLLNLCSR-SFSMKTTLMLA 168

Human   136 KQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFR 200
            .|||..:|.:|...|:||||||.||.|| |.....:.||:|||||:::.:    :|..::: |:.
  Fly   169 DQILARVELLHRRCFIHRDIKPDNFLMG-LNRHQTQVYMIDFGLAKKFYS----LRTQKHI-GYT 227

Human   201 ------GTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEH-- 257
                  ||.|||||.|| ..|..|.|||.|:.|:|:.|..|:|||:.|:.:.|.    :|||.  
  Fly   228 ENRDLVGTARYASVRAH-YAEQSRRDDLESVGYLLLYFQRGRLPWQGIRAQSQA----QKYEKIA 287

Human   258 --------RMLLKHMPSEFHLFLDHIASLDYFTKPDY----QLIMSVFENSMKERGIAENEAFDW 310
                    :.|...:|.||.::|.:...|.:..||||    ||...:|.|..|    ..:..|||
  Fly   288 EYKANIPLQQLCSGLPVEFFMYLKYCRKLHFAEKPDYVYLQQLFKVLFRNQYK----VCDFLFDW 348

Human   311 EKAGTDALLSTSTSTPPQQNTRQTAA---MFGVVNVTPVP--------------------GDLL- 351
                  .:|...:   |:|.::|...   ..|..||....                    |||| 
  Fly   349 ------VVLKRES---PEQQSQQKGRERDRGGKRNVVVQKERHRNKDRDSDTQRCRIKNGGDLLE 404

Human   352 -REN--------TEDVLQGEH--------------LSDQENAPPILPGR 377
             .||        .||..|.:|              |.|::...|::..|
  Fly   405 IEENESTTGEDPNEDKPQKKHGKACSCSYHLQKKRLQDRDRRAPLMTER 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTBK1XP_016866853.1 None
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 102/278 (37%)
SPS1 67..>306 CDD:223589 93/253 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.