DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTBK1 and CG7094

DIOPT Version :9

Sequence 1:XP_016866853.1 Gene:TTBK1 / 84630 HGNCID:19140 Length:1409 Species:Homo sapiens
Sequence 2:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster


Alignment Length:323 Identity:106/323 - (32%)
Similarity:165/323 - (51%) Gaps:35/323 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     7 ALKDETNMSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVE--SAQQ 69
            |.::.||  |....|.:.....::..:::::|.||.|.||:||..:.:.....||:|||  .|:.
  Fly     2 AKQEATN--GKVRNASLHLEKLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKY 64

Human    70 PKQVLKMEV-AVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADL-----RRSQPRGTFTL 128
            |:.:.:.:| ..|.:..|...:..: ||.:|  :|.:||.|.|.:|.:|     ||      |:|
  Fly    65 PQLIYEAKVYEQLARCPGFPTLLHY-GCEKN--YNAMVMDLLGPSLEELFNLCKRR------FSL 120

Human   129 STTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVR-P 192
            .|.|.|..|:|..||.:|..||:||||||.||.|| |.....|.|::||||:::|.:...::. |
  Fly   121 KTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMG-LDRHCNKLYLIDFGLSKRYKDIESEIHIP 184

Human   193 PRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEH 257
            .|......|||||||:||....|..|.||:.|:.|.|:.|.:|:|||:.|....:    |:|||.
  Fly   185 YRTDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANK----KQKYEK 245

Human   258 ----------RMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDW 310
                      ..|.|..||||.|.:.::.:|.:...||:..:..:|....:......:..:||
  Fly   246 ILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDW 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTBK1XP_016866853.1 None
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 98/278 (35%)
SPS1 26..>266 CDD:223589 92/253 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.