DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KIRREL3 and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:572 Identity:118/572 - (20%)
Similarity:187/572 - (32%) Gaps:171/572 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    34 CLVLGYMA--KDKFRRMNEGQVYS------FSQQP------QDQVVVSGQPVTLLCAIPEYDGF- 83
            ||:...:|  .|.....|.|.|..      .|:.|      ::..|.:|:.|.|.|::.....: 
  Fly    18 CLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYK 82

Human    84 VLWIKDGLALGVGRDLSSYPQ--YLVVGNH-------LSGEH---------HLKILRAELQDDAV 130
            |.|:             .:.|  .|.|.||       :|..|         .|.|...:.:|...
  Fly    83 VAWM-------------HFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGR 134

Human   131 YECQAIQAAIRSRPARLTVLVPPDDPVILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEV 195
            |.||......:::...:.|:|||:....|....|.:|.||.:.|.|.| ...|..:|.|.|... 
  Fly   135 YMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKA-KGSPEPTIKWKRDDG- 197

Human   196 INGATYSKTL-LRDGKRESI----VSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHP 255
             |....:||| :.|.:.:|:    :|.|.:.        :.:|.|:| .:|......:.:.:...
  Fly   198 -NKIVINKTLEVHDLETDSLELERISRLHMG--------AYLCIASN-GVPPSVSKRIKVSVDFS 252

Human   256 PLVNLSVEPQPVLEDNV---VTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEP 317
            |:|.:   |..::...:   :|..|..:|||....|...:..|:|.|:|  .|:|          
  Fly   253 PMVWI---PHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESS--KYKT---------- 302

Human   318 VSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKRGSGVV 382
                                      .|.|                  |:||....         
  Fly   303 --------------------------ETIP------------------GHPSYKAT--------- 314

Human   383 LSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCF 447
                ..||:.:|:..|.|.|.|.|..|| |..:..:.|.::.||......|...|.         
  Fly   315 ----MRLTITNVQSSDYGNYKCVAKNPR-GDMDGNIKLYMSSPPTTQPPPTTTTLR--------- 365

Human   448 IRSTPPPDRIAWSWKENVLESGTS----GRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAW 508
             |:|.....||.....|...:|..    |.....:: ...|..|...:||:...| ::....|..
  Fly   366 -RTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNSV-IASGKSSIKYLSNLNEID-KSKQKLTGS 427

Human   509 NSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMAT 560
            :..|.|.      .:|....|...|.|.|.|:...|          |.|:.|
  Fly   428 SPKGFDW------SKGKSSGSHGNLMASSWPLICCI----------LALLTT 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845 21/115 (18%)
IG_like 60..149 CDD:214653 21/113 (19%)
I-set 156..249 CDD:254352 24/97 (25%)
Ig2_KIRREL3-like 171..252 CDD:143236 19/85 (22%)
Ig_2 260..337 CDD:290606 13/79 (16%)
I-set 341..422 CDD:254352 17/80 (21%)
IGc2 355..406 CDD:197706 10/50 (20%)
Ig5_KIRREL3 424..521 CDD:143306 19/100 (19%)
IG_like 432..521 CDD:214653 17/92 (18%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 21/108 (19%)
Ig 69..139 CDD:143165 17/82 (21%)
IG_like 165..249 CDD:214653 23/95 (24%)
IGc2 172..237 CDD:197706 20/76 (26%)
IG_like 267..348 CDD:214653 28/150 (19%)
Ig 270..339 CDD:299845 27/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.