DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLF11 and sr

DIOPT Version :9

Sequence 1:NP_003588.1 Gene:KLF11 / 8462 HGNCID:11811 Length:512 Species:Homo sapiens
Sequence 2:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster


Alignment Length:176 Identity:60/176 - (34%)
Similarity:83/176 - (47%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   319 AQAAPAPQPVFVGPAVPQGAVML--VLPQGALPPPAPCAANVMAAGNTKLLPLAPAPVFITSSQN 381
            |.||.|.|.....|:..:|..:|  |..|..:|              .||:|:.|.......|:.
  Fly   979 AAAAAAVQLAEYSPSTSKGHEILSQVYQQSTVP--------------LKLVPVKPRKYPNRPSKT 1029

Human   382 CVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRR 446
            .|      ..|.|.|....|.:.:.:|..|..|:|.|||:|||.|..  |.:.|:|||.|:.|.|
  Fly  1030 PV------HERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRI--CMRSFSRSDHLTTHIR 1086

Human   447 THTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTK----KIPGWQAE 488
            ||||||.|.|.:|.|:|.|||...:||:.|:..:    |:.|.|.:
  Fly  1087 THTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKEKVRGEQQQ 1132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLF11NP_003588.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..128
COG5048 393..>449 CDD:227381 23/55 (42%)
zf-C2H2 394..418 CDD:278523 7/23 (30%)
C2H2 Zn finger 399..418 CDD:275368 5/18 (28%)
zf-H2C2_2 410..437 CDD:290200 12/26 (46%)
C2H2 Zn finger 426..448 CDD:275368 9/21 (43%)
zf-H2C2_2 440..463 CDD:290200 13/22 (59%)
zf-C2H2 454..476 CDD:278523 10/21 (48%)
C2H2 Zn finger 456..476 CDD:275368 9/19 (47%)
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 7/23 (30%)
C2H2 Zn finger 1038..1060 CDD:275368 6/21 (29%)
zf-H2C2_2 1052..1077 CDD:290200 12/26 (46%)
C2H2 Zn finger 1068..1088 CDD:275368 9/21 (43%)
zf-H2C2_2 1080..1105 CDD:290200 14/24 (58%)
C2H2 Zn finger 1096..1116 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.