DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB37 and PDR8

DIOPT Version :10

Sequence 1:NP_001116242.1 Gene:ZBTB37 / 84614 HGNCID:28365 Length:503 Species:Homo sapiens
Sequence 2:NP_013368.1 Gene:PDR8 / 850971 SGDID:S000004256 Length:701 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:24/129 - (18%)
Similarity:49/129 - (37%) Gaps:45/129 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   356 YLREQEVSER-----WF---------RYN----PRLT------CIYCAKSFNQKGSLD-RHMRL- 394
            ||.|.|.:::     ||         .|:    |.::      .|:.|::| |..|:| |.::| 
Yeast   331 YLNESEETKQNLRCIWFWALFLDVSTSYDIGNPPSISDDLLDLSIFTAQNF-QSPSIDFRRVKLM 394

Human   395 --HMGITPFVCRMCGKKYTRKDQLEYHIR------------KHTGNKPFHCHVCGKSFPFQAIL 444
              .:.::.|..|...|:...:....:.:|            :|..|..::..:    .||..::
Yeast   395 HDFLDVSRFTTREIHKREMNEKLTTFSLRLIEFIQSNFSPIEHYTNSVYYSDI----DPFDILI 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB37NP_001116242.1 BTB_POZ_ZBTB37 7..129 CDD:349531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..344
C2H2 Zn finger 375..395 CDD:275368 8/23 (35%)
zf-H2C2_2 387..412 CDD:463886 7/28 (25%)
zf-C2H2 401..423 CDD:395048 4/33 (12%)
C2H2 Zn finger 403..423 CDD:275368 3/31 (10%)
zf-H2C2_2 416..438 CDD:463886 3/33 (9%)
C2H2 Zn finger 431..449 CDD:275368 2/14 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 457..503
PDR8NP_013368.1 GAL4 25..68 CDD:214501
Fungal_trans 188..459 CDD:397964 24/129 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.