DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PARD6B and GUK1

DIOPT Version :9

Sequence 1:NP_115910.1 Gene:PARD6B / 84612 HGNCID:16245 Length:372 Species:Homo sapiens
Sequence 2:NP_010742.1 Gene:GUK1 / 852065 SGDID:S000002862 Length:187 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:34/163 - (20%)
Similarity:62/163 - (38%) Gaps:49/163 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   217 EVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQIE 281
            ||||.:.:..|:|:...|:               :.|..:..::.||:...||..|:    :|:.
Yeast    45 EVNGKDYNFVSVDEFKSMI---------------KNNEFIEWAQFSGNYYGSTVASV----KQVS 90

Human   282 PSFEPEDEDSEEDDIIIEDNGVP--QQIPK--------AVPNTESLESLTQIELSFESGQNGFIP 336
            .|       .:...:.|:..||.  :.||:        |.|:.|.|:...:          |...
Yeast    91 KS-------GKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLE----------GRGT 138

Human   337 SNEVSLAAIASSSNTEF---ETHAPDQKLLEED 366
            ..|.|:....|::..|.   ||.|.|:.::.:|
Yeast   139 ETEESINKRLSAAQAELAYAETGAHDKVIVNDD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PARD6BNP_115910.1 PB1_Par6 17..96 CDD:99724
Interaction with PARD3 and CDC42. /evidence=ECO:0000250 126..253 7/35 (20%)
PDZ_signaling 156..247 CDD:238492 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..292 8/38 (21%)
GUK1NP_010742.1 guanyl_kin 3..185 CDD:213788 34/163 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.