DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMEM185A and CG13919

DIOPT Version :10

Sequence 1:NP_115897.1 Gene:TMEM185A / 84548 HGNCID:17125 Length:350 Species:Homo sapiens
Sequence 2:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster


Alignment Length:169 Identity:40/169 - (23%)
Similarity:69/169 - (40%) Gaps:51/169 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     4 RGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASVG-TGVWAR 67
            |.||..|         .:|:|.:||.||||....|:::..|.|:|.:.:::|:...:. ...| |
  Fly     6 RALFTWF---------IVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIYVIIKFIRKW-R 60

Human    68 NPQYRAEGETCVE-----FKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLFFVSPVSV 127
            |       .||:.     :|..:..|   ||.:..:|::|..:|....      :|::    |:|
  Fly    61 N-------LTCLTDLLFLYKWNIAGV---LLTIASQVMICLTLEYPQQ------IPIY----VTV 105

Human   128 AACVWGFRHDRSLELEILCSVNILQFIFIALRLDKIIHW 166
            |..:            :|.|..|   .::..||.|...|
  Fly   106 APVI------------LLLSTAI---FYVGSRLGKREGW 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMEM185ANP_115897.1 Tmemb_185A 31..253 CDD:402059 31/142 (22%)
Mediates interaction with MAP1B. /evidence=ECO:0000269|PubMed:15525354 298..350
CG13919NP_647637.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.