DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JPH4 and CG3222

DIOPT Version :10

Sequence 1:NP_115828.2 Gene:JPH4 / 84502 HGNCID:20156 Length:628 Species:Homo sapiens
Sequence 2:NP_648333.1 Gene:CG3222 / 39114 FlyBaseID:FBgn0036014 Length:379 Species:Drosophila melanogaster


Alignment Length:47 Identity:19/47 - (40%)
Similarity:27/47 - (57%) Gaps:3/47 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   106 YAGLWKD--GFQDGYGTETYSDGGTYQGQWQAGKRHGYG-VRQSVPY 149
            |.|.|..  ...||:|:..|.||..|:|::..|:.|||| :|.:.||
  Fly    19 YEGAWDRLVNVMDGFGSYRYPDGSEYRGRFHQGQFHGYGHLRLAQPY 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JPH4NP_115828.2 COG4642 <4..143 CDD:443680 16/39 (41%)
MORN 1 50..72
MORN 2 74..95
MORN 3 96..117 3/12 (25%)
MORN 4 118..140 7/21 (33%)
MORN 5 141..163 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..276
COG4642 <281..>336 CDD:443680
MORN 7 317..339
MORN 8 340..362
PRK07003 <369..>606 CDD:235906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..602
CG3222NP_648333.1 COG4642 <17..97 CDD:443680 19/47 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.