DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JPH4 and CG14490

DIOPT Version :10

Sequence 1:NP_115828.2 Gene:JPH4 / 84502 HGNCID:20156 Length:628 Species:Homo sapiens
Sequence 2:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster


Alignment Length:131 Identity:46/131 - (35%)
Similarity:62/131 - (47%) Gaps:32/131 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    18 GWEAG-RAHGYGVCTGPGAQGEYSGCW----AHGFESLGVFTGPGGHSYQGHWQQGKREGLGVER 77
            |:.:| |:..|     ||  |:|.|.|    .|||   ||.....|..|:||||:|:|.|:|..|
  Fly     7 GYSSGVRSQRY-----PG--GQYQGKWLGQQPHGF---GVKQTSSGLVYEGHWQKGQRHGIGSLR 61

Human    78 KSRWTYRGEWLGGLKGRSGVWESVSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHGYG 142
            :..          |.||   .|.:    |.|.|::..:.|.|.:.|.||..|.|||.|.:|.|.|
  Fly    62 RKE----------LDGR---MERI----YVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEG 109

Human   143 V 143
            :
  Fly   110 I 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JPH4NP_115828.2 COG4642 <4..143 CDD:443680 45/129 (35%)
MORN 1 50..72 10/21 (48%)
MORN 2 74..95 4/20 (20%)
MORN 3 96..117 4/20 (20%)
MORN 4 118..140 10/21 (48%)
MORN 5 141..163 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..276
COG4642 <281..>336 CDD:443680
MORN 7 317..339
MORN 8 340..362
PRK07003 <369..>606 CDD:235906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..602
CG14490NP_611274.1 COG4642 <18..173 CDD:443680 42/115 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.