DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JPH4 and Rsph1

DIOPT Version :10

Sequence 1:NP_115828.2 Gene:JPH4 / 84502 HGNCID:20156 Length:628 Species:Homo sapiens
Sequence 2:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster


Alignment Length:330 Identity:79/330 - (23%)
Similarity:106/330 - (32%) Gaps:91/330 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    13 GCYVGGWE-AGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHSYQGHWQQGKREGLGV- 75
            |.|:||.. ||:..|.|              ||         ..|.|..|.|::::|:|.|:|| 
  Fly    25 GLYIGGRNAAGQRQGRG--------------WA---------ILPNGDQYDGNYRKGRRHGIGVY 66

Human    76 --ERKSRWTYRGEWLGGLKGRSGVWESVSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKR 138
              :..||  |.|::..|.:...|::....|..|.|.|:...:.|.|...|.:|..|.|.|..|:|
  Fly    67 VFKDGSR--YYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQR 129

Human   139 HGYGVRQSVPYH-------------QAALLRSPRRT---SLDSGHSDPPTPPPPLPLPGDEGGSP 187
            ||.|:     ||             ..|...|..||   .|..|:.|..|               
  Fly   130 HGVGI-----YHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCT--------------- 174

Human   188 ASGSRGGFVLAGPGDADGASSRKRTPAAGGFFRRSLLLSGLRAGGRRSSLGSKRGSL---RSEVS 249
                    :|.|..|....|.    ||...|..|.|||.............|....:   ...:.
  Fly   175 --------ILHGIWDNLYPSG----PAVFSFNNRYLLLGYFLPASYNMKAISNEDEMEDAEERLE 227

Human   250 SEVGSTGPPGS-----------EASGPPAAAPPALIEGSATEVYAGEWRADRRSGFGVSQRSNGL 303
            .|:|...|...           :.|..|....|..|..|...|.:.......||...:|....|.
  Fly   228 DEMGEAEPMEPTLWFAQEMAVYDFSLLPQEPVPLAISDSELSVCSLSTEPSMRSEEKISWYGEGE 292

Human   304 RYEGE 308
            ..|||
  Fly   293 EAEGE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JPH4NP_115828.2 COG4642 <4..143 CDD:443680 40/133 (30%)
MORN 1 50..72 6/21 (29%)
MORN 2 74..95 7/23 (30%)
MORN 3 96..117 5/20 (25%)
MORN 4 118..140 8/21 (38%)
MORN 5 141..163 7/37 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..214 10/58 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..276 8/58 (14%)
COG4642 <281..>336 CDD:443680 8/28 (29%)
MORN 7 317..339
MORN 8 340..362
PRK07003 <369..>606 CDD:235906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..602
Rsph1NP_609609.1 COG4642 <14..141 CDD:443680 43/145 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.