DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ndhB and ND2

DIOPT Version :9

Sequence 1:NP_051103.2 Gene:ndhB / 844713 -ID:- Length:512 Species:Arabidopsis thaliana
Sequence 2:YP_009047266.1 Gene:ND2 / 19893529 FlyBaseID:FBgn0013680 Length:341 Species:Drosophila melanogaster


Alignment Length:380 Identity:93/380 - (24%)
Similarity:171/380 - (45%) Gaps:69/380 - (18%)


- Green bases have known domain annotations that are detailed below.


plant   130 LLFILTATLGGMFLCGANDLITIFVAPECFSLCSYLLSGYTKKDIRSNEATMKYLLMGGASSSIL 194
            :|||....:|.:....:|..:..::..| .:|.|::.......::.|.||::||.|....:|::|
  Fly     8 ILFITIMIIGTLITVTSNSWLGAWMGLE-INLLSFIPLLSDNNNLMSTEASLKYFLTQVLASTVL 71

plant   195 VHGFSWLYGSSGGEIELQEIVNGLINTQMYNSPGISIALIFITVGIGFKLSLAPSHQWTPDVYEG 259
            :  ||.:.      :.|:..:|..|| :.:.|..|..||:       .|...||.|.|.|::.||
  Fly    72 L--FSSIL------LMLKNNMNNEIN-ESFTSMIIMSALL-------LKSGAAPFHFWFPNMMEG 120

plant   260 SPTPVVAFLSVTSKVAASASATRIFDIPFYFSS--NEWHLLLEILAILSMIFGNLIAITQTSMKR 322
            ........|....|:|           |....|  |..:||| |..|||:|.|.:..:.|||:::
  Fly   121 LTWMNALMLMTWQKIA-----------PLMLISYLNIKYLLL-ISVILSVIIGAIGGLNQTSLRK 173

plant   323 MLAYSSIGQIGYVIIGIIVGDSNGGYASMITYMLFYIAMNLGTFACIILFGLRTGTDNIRDYAGL 387
            ::|:|||..:|:::..:::.:|     ..:.|..||..:   :|....:|.: ....::......
  Fly   174 LMAFSSINHLGWMLSSLMISES-----IWLIYFFFYSFL---SFVLTFMFNI-FKLFHLNQLFSW 229

plant   388 YTKDPFLALSLALCLLSLGGLPPLAGFFGKLHLFWCGWQ----AGLYFLVSIGLLTSVLSIYYYL 448
            :.....|..:|.:..||||||||..||..|    |...|    ...||::::.::::::::::||
  Fly   230 FVNSKILKFTLFMNFLSLGGLPPFLGFLPK----WLVIQQLTLCNQYFMLTLMMMSTLITLFFYL 290

plant   449 KIIKLLMTGRNQEITPHMRNYRISPLRSN-------NSIELSMIVCVIASTIPGI 496
            :|.          .:..|.||    ..:|       |||..:|.:.:...:|.|:
  Fly   291 RIC----------YSAFMMNY----FENNWIMKMNMNSINYNMYMIMTFFSIFGL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ndhBNP_051103.2 ndhB 17..510 CDD:176990 93/380 (24%)
ND2YP_009047266.1 ND2 1..340 CDD:214442 93/380 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2779
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I2120
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153818at2759
OrthoFinder 1 1.000 - - FOG0002463
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102147
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.