DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEGF11 and CG17147

DIOPT Version :9

Sequence 1:NP_001371957.1 Gene:MEGF11 / 84465 HGNCID:29635 Length:1140 Species:Homo sapiens
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:359 Identity:68/359 - (18%)
Similarity:106/359 - (29%) Gaps:139/359 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   393 SCPVGYYGDGCQL---------PCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSS 448
            |..||.|.:.|:|         |.||.....|:...|                           :
  Fly    22 SASVGEYEELCRLFKNGTKVRKPGTCDQYIQCYDGNG---------------------------T 59

Human   449 ICSCNNGGTCSPVDGSCT---------CKEGWQGLDCTLPCPSGTW---GLNCNESCTCANGAAC 501
            :.:|.:..:.:|..|||.         |....:|||       |.|   ...|::...|.||.  
  Fly    60 VLTCPSNQSFNPSKGSCVDTLANSNKYCGNRCEGLD-------GEWVADPTECHKYFYCMNGV-- 115

Human   502 SPIDGSC-----------SCTPGW------LGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTG 549
             |:.|.|           ||..|.      :.:.|||...:..|    ....||::...||....
  Fly   116 -PLAGMCPVGQHFDERSQSCLYGVDSMCVDVNNICELVAENTKF----RNEKDCAYYYECDKTGN 175

Human   550 HCCCLAGWTGIRCDSTCPPGRW----GPNC----SVSCS-------CENGGSCSPEDGSCECAPG 599
            |       ....|..|.....:    ..||    .|.|:       |.:..:.:.:.....|...
  Fly   176 H-------ASKSCTVTSKKREYFDVESGNCVEANKVECTAHSKENVCTSSTTMTFKSDQATCRGY 233

Human   600 FRGPLCQRI------------CPPGFY----GHGCAQPCP-LCVH-------------SSRPCHH 634
            |   :|:.:            ||.|::    ...||.|.. :|.|             ||..||:
  Fly   234 F---VCKALYPVADLDPLWTQCPEGYFFDEDRQLCANPTTVVCTHNRCDGRGTMLVTSSSNNCHN 295

Human   635 ISGICECLPGFSGALCNQVCAGGYFGQDCAQLCS 668
               ...|:.  :..:..:.|...:|..:..:.||
  Fly   296 ---YIRCVD--NKEVTEETCHWDHFFDETVEACS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEGF11NP_001371957.1 EMI 26..93 CDD:400092
EGF_CA 275..320 CDD:419698
EGF_CA 362..409 CDD:419698 7/24 (29%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 9/59 (15%)
ChtBD2 89..136 CDD:214696 14/56 (25%)
CBM_14 278..332 CDD:279884 9/52 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.