DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEGF11 and CG11674

DIOPT Version :9

Sequence 1:NP_001371957.1 Gene:MEGF11 / 84465 HGNCID:29635 Length:1140 Species:Homo sapiens
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:393 Identity:83/393 - (21%)
Similarity:125/393 - (31%) Gaps:105/393 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   586 SCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICEC-LPGFSGAL 649
            |||.:   .:||...||......|.....|.|...||.......:..:.|.|.|.| :|   .|:
  Fly    28 SCSSD---AQCAQFERGRCVDMACICTARGSGERVPCTPLEERLKLTNIIGGACPCPMP---NAI 86

Human   650 CNQ-----VCAGGYFGQDCAQLCSCANNGTCSPIDGSC----QC-----FPGWIGKDCSQACPPG 700
            |:.     .|:.|:...|..:.|..|    ..|:.|||    ||     |...||..|       
  Fly    87 CHTRWQQCHCSEGHVSSDDRRRCLPA----VVPVGGSCEFQQQCQRADRFSSCIGNQC------- 140

Human   701 FWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGAS-CDHI 764
                .|.:....|.|...|....:|                  ...||||   .|  ||| |...
  Fly   141 ----LCLNQFEFHEGRCLSVLQSSC------------------LEDKDCG---SC--GASICLTK 178

Human   765 SGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRC-DQAALM 828
            :.:|.|...|...|...:|..|: .||          .||:| :..|..:.|..| || |...:.
  Fly   179 TKRCGCSKNFVHNHNMTKCIKGS-AYG----------DTCEH-SSPCKLNLGADG-RCLDHLCVC 230

Human   829 MEELNPYTKISPALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQKEKGRDLAPRVSYTPAM 893
            .....|....:.....|...:.||..:..:....:|..|                        |:
  Fly   231 RSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIVPFG------------------------AL 271

Human   894 RMTSTDYSLSDLSQSSSHAHCFSNSSYHALAC--GGPATSQASTLDRNSPTKLSNKSLDRDTAGW 956
            ....::..:..:.|.::.|     |..|.:.|  |..:.|:...|:.|....:.|.:.:....|:
  Fly   272 CRNDSECRMQPMDQENATA-----SIGHPMVCNWGECSCSKTHRLEDNKCVFVENSATNYQLRGF 331

Human   957 TPY 959
            ..:
  Fly   332 VAF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEGF11NP_001371957.1 EMI 26..93 CDD:400092
EGF_CA 275..320 CDD:419698
EGF_CA 362..409 CDD:419698
CG11674NP_572948.1 EB 96..153 CDD:279949 18/71 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.