DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEGF11 and NimB2

DIOPT Version :9

Sequence 1:NP_001371957.1 Gene:MEGF11 / 84465 HGNCID:29635 Length:1140 Species:Homo sapiens
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:364 Identity:94/364 - (25%)
Similarity:120/364 - (32%) Gaps:139/364 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    88 CCPGYYESGDF---CIPLCTEECVHGRCVSPDTCHCEPGWGGPDCSSGCDSDHWGPH-------C 142
            ||.||..:...   |.|:|.::|.:|.|.:|:||.|.||                 |       |
  Fly   167 CCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPG-----------------HVRTAEGKC 214

Human   143 SNRCQ--CQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECL 205
            .:.|.  |.||.                   |:|           :..|:||.|.|.:|.     
  Fly   215 ISTCPLGCGNGV-------------------CDE-----------RNECKCREGYSLEPE----- 244

Human   206 CAPGYTGVYCEELCPPGSHGAHCEL-RCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQ 269
                 |..||:..|.||     |.. ||...|         :|||..|:..|.          ..
  Fly   245 -----TRKYCQPECKPG-----CSFGRCVAPN---------KCACLDGYRLAA----------DG 280

Human   270 NCSQDCPCHHGGQCDHVTGQCHCTAGY--MGDRCQEECPFGSFGFQCSQHCDCHNGGQCSPTTGA 332
            :|...|.....|:|. ..|.|:|.|||  :..||:..|..           .|.||....|  ..
  Fly   281 SCEPVCDSCENGKCT-APGHCNCNAGYLKLQGRCEPICSI-----------PCKNGRCIGP--DI 331

Human   333 CECEPGYKGPRCQERLCPEGLHGPGCTLPC---PCDADNTISCHPVTGAC-------TCQPGWSG 387
            |||..|::..|......|:      |.|||   .|..:|...|.  ||..       .|||    
  Fly   332 CECASGFEWDRKSAECLPK------CDLPCLNGVCVGNNQCDCK--TGYVRDEHQRNICQP---- 384

Human   388 HHCNESCPVGYYGDGCQLP--CTCQNGADCHSITGGCTC 424
             ||.:.|..||    |..|  |.|:.|.....|.|..||
  Fly   385 -HCPQGCQNGY----CSAPNFCICRPGFIKSGIKGRQTC 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEGF11NP_001371957.1 EMI 26..93 CDD:400092 3/4 (75%)
EGF_CA 275..320 CDD:419698 12/46 (26%)
EGF_CA 362..409 CDD:419698 17/58 (29%)
NimB2NP_723857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.