DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DYRK2 and CG7028

DIOPT Version :9

Sequence 1:NP_006473.2 Gene:DYRK2 / 8445 HGNCID:3093 Length:601 Species:Homo sapiens
Sequence 2:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster


Alignment Length:350 Identity:109/350 - (31%)
Similarity:175/350 - (50%) Gaps:23/350 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   203 YDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQ-HVALKMVRNEKRFHRQAAEE 266
            :||.:|.|.....:.:..||.|....|:|.|..||:..|....| :||:|::||.:..|:....|
  Fly   573 WDDAEGYYRVRIGEVLDNRYLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIRNNEIMHKTGLRE 637

Human   267 IRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKK-NKFQGFSLPLVRKFAH 330
            :.||:.|...|.::..:.:.:..:|..:.|:||.||.|:|||.|::|| .|..|..:..||.:..
  Fly   638 LEILKKLNDADPEDRFHCLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYTQ 702

Human   331 SILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGS-SCYEHQRVYTYIQSRFYRAPEVI 394
            .:...|..|.|..|:|.|:||:|||:.:.... :|:.|||| |......:..|:.|||||:||:|
  Fly   703 QLFLALKLLKKTGILHADIKPDNILVNENNLI-LKLCDFGSASAISDNEITPYLVSRFYRSPEII 766

Human   395 LGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLG-MPSQKLLDASKRAKNFVSS 458
            ||..|...||.||.||.:.||.||..|..|:.....|...:::.| :|::.:.....|.::|..|
  Fly   767 LGIPYDYGIDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQS 831

Human   459 KGYPRYCTVTTLSDGS-----VVLNGGRSRRGKLRG----PPESREWGNALKGCDDPLFLDFLKQ 514
            ..: .|..:..|::..     .|:...||.:.:|..    |.:.......||        |.|:.
  Fly   832 CNF-LYHEIDKLTEREKIVVMPVVKPSRSLQQELIADQNLPDDQHRKVTQLK--------DLLEN 887

Human   515 CLEWDPAVRMTPGQALRHPWLRRRL 539
            ....|||.|::..|||.||:::.::
  Fly   888 MFALDPAKRISLNQALVHPFIQEKM 912

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DYRK2NP_006473.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
PKc_DYRK2_3 156..535 CDD:271126 109/344 (32%)
Nuclear localization signal. /evidence=ECO:0000305|PubMed:19965871 189..191
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 105/326 (32%)
S_TKc 599..908 CDD:214567 102/318 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.