DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABLIM2 and CG4328

DIOPT Version :9

Sequence 1:XP_005248071.1 Gene:ABLIM2 / 84448 HGNCID:19195 Length:701 Species:Homo sapiens
Sequence 2:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster


Alignment Length:508 Identity:100/508 - (19%)
Similarity:167/508 - (32%) Gaps:151/508 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     5 GGDTVSQPQAAPS-------PL---------------EKSPSTAILCNTCGNVCKGEVLRVQDKY 47
            |.|..:.|.|.||       ||               ..||..:...:.|..:|...::||.:..
  Fly   154 GMDGFATPAAPPSASNTPQAPLGMASNSGMGMELGLAMASPQLSQCAHCCQPICDRYIMRVVENS 218

Human    48 FHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCF 112
            ||..|..|.||...|.. ..:.|:|:..|.:||:|||                            
  Fly   219 FHEGCLKCTACSLHLVH-SCYAREGKLYCRVDYERLY---------------------------- 254

Human   113 VCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSVGSSAHLSQGLRS-CGGCGTEIKNGQALVALDK 176
                                                      :|: |.|||.:|...:.::...:
  Fly   255 ------------------------------------------IRNHCLGCGLKIAADELVMRCHE 277

Human   177 H-WHLGCFKCKSCGKLL--NAEYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEA----GEK 234
            : :||.||.|..||.||  ..:|:.|.|..:|..||           ||.:  .:|:.    |::
  Fly   278 NVFHLKCFACVVCGALLKKGEQYVVKQGQLFCRFDY-----------EKEV--EMLQGYDFYGDE 329

Human   235 HYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQA--ARTEDRNKETRTSSESIISVPASSTS 297
            .:.|.           .:|.....:..:|.:...|:|  |..|...|..|...|::     :..:
  Fly   330 LFPPK-----------LDGRRGPKRPRTILNTQQRRAFKASFEVSPKPCRKVRENL-----AKDT 378

Human   298 GSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGESPQLLSPT 362
            |...|::      ::......|.:.|.:.....:.|         |..|.|.|...||  |.|..
  Fly   379 GLSLRIV------QVWFQNQRAKVKKIQKKAKQEPP---------SKGASDSQDSQES--LDSSL 426

Human   363 PTEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQHPSPTS 427
            .|:...:..|..:.:..||.||.|..|.|...|.:..|. ..|...:.....:| :.:..|...:
  Fly   427 ATKIKDEAHSDSESQLESPYSTTSDGLTRMRCTIKDEQE-QVPFNCMETNKENC-NKNSEPILNT 489

Human   428 VFRHHYIPYFRGSESGRSTPSLSVLSDSKPPPSTYQQAPRHFHVPDTGVKDNI 480
            :....|..:.:.......||.::.:.......|:|.:........:.||||::
  Fly   490 ILGLSYATFQQLMGPFAQTPMINPIDRLYSMQSSYFRPEELQSYGECGVKDSM 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABLIM2XP_005248071.1 LIM1_abLIM 29..80 CDD:188713 14/50 (28%)
LIM2_abLIM 85..140 CDD:188714 0/54 (0%)
LIM3_abLIM 158..209 CDD:188715 18/53 (34%)
LIM4_abLIM 217..272 CDD:188716 9/60 (15%)
AbLIM_anchor 282..665 CDD:292800 38/199 (19%)
VHP 667..701 CDD:280388
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757 15/52 (29%)
LIM 259..313 CDD:295319 18/53 (34%)
COG5576 <332..439 CDD:227863 25/139 (18%)
HOX 341..393 CDD:197696 10/62 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.