DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABLIM2 and Pax

DIOPT Version :9

Sequence 1:XP_005248071.1 Gene:ABLIM2 / 84448 HGNCID:19195 Length:701 Species:Homo sapiens
Sequence 2:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster


Alignment Length:221 Identity:74/221 - (33%)
Similarity:100/221 - (45%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    29 CNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQ 93
            ||.|.....|:|:....|.:|.:.|.|..|..:|....||.|.|...|..||..|:..||..|:.
  Fly   348 CNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCNG 412

Human    94 FIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSVGSSAHLSQGLRSC 158
            .|..:.|:||.||:|.:.|.||.|...|         |:|...::...|..  .:.:.......|
  Fly   413 AILDKCVTALDKTWHTEHFFCAQCGQQF---------GEEGFHERDGKPYC--RNDYFEMFAPKC 466

Human   159 GGCGTEIKNGQALVALDKHWHLGCFKCKSCGK-LLNAEYISKDGLPYCEADYHAKFGIRCDSCEK 222
            .||...|.... :.||:..||..||.|:.|.: .....:...:||||||..||||.|..|..|.|
  Fly   467 NGCNRAIMENY-ISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCSK 530

Human   223 YITGRVLEAGEKHYHPS---CALCVR 245
            .||||.:.|..|.:||.   ||.|::
  Fly   531 PITGRCITAMFKKFHPEHFVCAFCLK 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABLIM2XP_005248071.1 LIM1_abLIM 29..80 CDD:188713 16/50 (32%)
LIM2_abLIM 85..140 CDD:188714 17/54 (31%)
LIM3_abLIM 158..209 CDD:188715 18/51 (35%)
LIM4_abLIM 217..272 CDD:188716 14/32 (44%)
AbLIM_anchor 282..665 CDD:292800
VHP 667..701 CDD:280388
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 17/51 (33%)
LIM2_Paxillin_like 407..458 CDD:188723 17/61 (28%)
LIM3_Paxillin_like 466..518 CDD:188724 18/52 (35%)
LIM4_Paxillin 525..576 CDD:188795 14/32 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.