DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABLIM2 and jub

DIOPT Version :9

Sequence 1:XP_005248071.1 Gene:ABLIM2 / 84448 HGNCID:19195 Length:701 Species:Homo sapiens
Sequence 2:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster


Alignment Length:250 Identity:58/250 - (23%)
Similarity:80/250 - (32%) Gaps:106/250 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    28 LCNTCGNVCK--GEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLY------ 84
            :|:|||...|  |:..:.....:|..||:|.:||..|....|:...|...|..||  :|      
  Fly   515 ICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDY--MYSGFQQT 577

Human    85 GTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSVGSSA 149
            ..:|..|...|...::.|:||:|||.||.|.||              .||:              
  Fly   578 AEKCAICGHLIMEMILQAMGKSYHPGCFRCCVC--------------NECL-------------- 614

Human   150 HLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLNAEYISKDGLP---------YC 205
                                                              ||:|         ||
  Fly   615 --------------------------------------------------DGVPFTVDVDHKIYC 629

Human   206 EADYHAKFGIRCDSCEKYITG--------RVLEAGEKHYHPSCALCVRCGQMFAE 252
            ..|||..|..:|.||.|.||.        ||:.. :|.:|..|.:|..||....:
  Fly   630 VNDYHRMFAPKCASCGKGITPVEGTDETVRVVSM-DKDFHVDCYICEECGMQLTD 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABLIM2XP_005248071.1 LIM1_abLIM 29..80 CDD:188713 16/52 (31%)
LIM2_abLIM 85..140 CDD:188714 16/54 (30%)
LIM3_abLIM 158..209 CDD:188715 5/59 (8%)
LIM4_abLIM 217..272 CDD:188716 14/43 (33%)
AbLIM_anchor 282..665 CDD:292800
VHP 667..701 CDD:280388
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 16/52 (31%)
LIM2_Ajuba_like 581..633 CDD:188741 21/129 (16%)
LIM3_Ajuba_like 641..702 CDD:188822 14/43 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.