DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atp1b4 and CG33310

DIOPT Version :9

Sequence 1:NP_445833.2 Gene:Atp1b4 / 84396 RGDID:620994 Length:356 Species:Rattus norvegicus
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:331 Identity:64/331 - (19%)
Similarity:119/331 - (35%) Gaps:111/331 - (33%)


- Green bases have known domain annotations that are detailed below.


  Rat    63 EEEEREEEEG-QGQSTGNAWWRKL---QIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYASLA 123
            :|:.|...:| :....|...||:|   :|..:|        .|.|  .|..|..:::...|    
  Fly   564 KEDRRTYYKGCEYHFPGRTEWRRLFFNKIHGKY--------KLRR--PSHWLYTLVFSVLY---- 614

  Rat   124 AVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPF-----------AHSLNFNFNVSEPETWQRY 177
               .||:.:..:|...::.....:..|...|.:||           ..:::|:.. :..|..::|
  Fly   615 ---ILFVIIFSMAWFDFIKDDASRKVPMIKMAQPFISFTPIGPRTNPKAVSFDPR-NSTEVMEKY 675

  Rat   178 VISLNGFLQGYNDSLQEEMNIDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTG 242
            . .:...|:.|                     ||...:.:        ...|:..|  .|||.:|
  Fly   676 A-GIMALLEKY---------------------GDYGHNPR--------FGTCTANE--KFGYPSG 708

  Rat   243 QPCILLKMNRIVGFRPE----FGDPVK-----------------------------VSCKVQKGD 274
            :||:.||:|||:||:.|    ..:.||                             ::|:..| |
  Fly   709 EPCVFLKVNRIIGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDK-D 772

  Rat   275 ENNIRSINYYPESA--------SFDLRYYPYYGKLTHV--NYTSPLVAMHFTDVVKNQEVPVQCQ 329
            :|.:  |.::||.|        ...:.|....||.:..  |..:.:||:...::..|:.|.:.|:
  Fly   773 KNVL--IEFHPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCK 835

  Rat   330 LKGKGI 335
            :..:.|
  Fly   836 MWAQNI 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atp1b4NP_445833.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..77 3/14 (21%)
Na_K-ATPase 90..348 CDD:395224 56/300 (19%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 34/142 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.