powered by:
Protein Alignment Timm10b and Tim9b
DIOPT Version :9
Sequence 1: | NP_001376161.1 |
Gene: | Timm10b / 84384 |
RGDID: | 71097 |
Length: | 100 |
Species: | Rattus norvegicus |
Sequence 2: | NP_001027074.1 |
Gene: | Tim9b / 3772213 |
FlyBaseID: | FBgn0027358 |
Length: | 117 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 30/73 - (41%) |
Similarity: | 42/73 - (57%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Rat 8 LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVHLMPALV 72
||||:||..:||::|||||.|||.:|..|.|...|:.|:..|..|....|..:|..||.:...:.
Fly 5 LRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNMMKVYVDVQTTIN 69
Rat 73 QRRMADYE 80
.:||.:.|
Fly 70 AKRMEEME 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166335584 |
Domainoid |
1 |
1.000 |
60 |
1.000 |
Domainoid score |
I10313 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
68 |
1.000 |
Inparanoid score |
I5237 |
OMA |
1 |
1.010 |
- |
- |
|
QHG46708 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007069 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm44851 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_110413 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13172 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5153 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
10 | 9.900 |
|
Return to query results.
Submit another query.