DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G74680 and sotv

DIOPT Version :9

Sequence 1:NP_565089.1 Gene:AT1G74680 / 843807 AraportID:AT1G74680 Length:461 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:369 Identity:80/369 - (21%)
Similarity:136/369 - (36%) Gaps:108/369 - (29%)


- Green bases have known domain annotations that are detailed below.


plant    67 KCDRDRDVLKVFMYDLPSEFHFGILNWHKKGSEIWPNVNNISTIPSYPGGLNRQHSVEYWLTLDL 131
            ||:.||  |||::|.| .||                              ::.|..    .|...
  Fly   102 KCEHDR--LKVYIYPL-QEF------------------------------VDEQSD----KTATT 129

plant   132 LASETPEIKRPCSSAAIRVKNSNEADIVFVPFFASLSYNRKSK-LRGNETSSDDRLLQERLVEFL 195
            |:||..:|......:.....|.||| .:|:|....|:.|...| |.|               ..|
  Fly   130 LSSEYFQILEAVLKSRYYTSNPNEA-CLFLPSLDLLNQNVFDKHLAG---------------AAL 178

plant   196 KSQDEWKRFDGKDHLIVAHHP---------------NSLLYARNFLGSAMFVLSDFGRYSSAIAN 245
            .|.|.|.|  |.:|:|....|               |::::...|         |...|....  
  Fly   179 ASLDFWDR--GANHIIFNMLPGGAPSYNTVLDVNTDNAIIFGGGF---------DSWSYRPGF-- 230

plant   246 LEKDIIAPYVHVVKTISNNESASFEKRPVLAYFQGAIYRKDGGTIRQELYNLLKDEK-------- 302
               |:..| |...:.:..:..|:.:::.:|...|..|..:...|:|:  .:|...|:        
  Fly   231 ---DVAIP-VWSPRLVRQHAHATAQRKFLLVVAQLNILPRFVRTLRE--LSLAHSEQLLLLGACE 289

plant   303 --DVHFAFGTVRGNGTKQTGKGMASSKFCL---NIAGDTPSSNRLFDAIVSHCVPVIISDQIELP 362
              |:.......:.:.:.:..:.::..||||   ::....|.   |.:.:..||:|||..|...||
  Fly   290 NLDLTMRCPLSQHHKSLEYPRLLSRGKFCLLGRSLRMGQPD---LVEIMSQHCIPVIAVDNYVLP 351

plant   363 FEDTLDYSGFSVFVHASE---AVKKEFLVNILRGITEDQWKKKW 403
            |||.:|:|..||.:..:|   .::|...::.:: |.|.|.:.:|
  Fly   352 FEDVIDWSLASVRIRENELHSVMQKLKAISSVK-IVEMQKQVQW 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G74680NP_565089.1 Exostosin 75..391 CDD:397245 72/347 (21%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069 74/349 (21%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.