DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPK15 and rl

DIOPT Version :9

Sequence 1:NP_565070.2 Gene:MPK15 / 843702 AraportID:AT1G73670 Length:576 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:366 Identity:163/366 - (44%)
Similarity:234/366 - (63%) Gaps:24/366 - (6%)


- Green bases have known domain annotations that are detailed below.


plant    75 IPNAEFFTEYGEAN----RYQIQEV---------VGKGSYGVVGSAIDTHTGERVAIKKINDVFD 126
            :.|....||..::|    |.||.||         :|:|:||:|.||.||.|.:|||||||:. |:
  Fly    10 VVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISP-FE 73

plant   127 HISDATRILREIKLLRLLLHPDVVEIKHIMLPPSRREFRDVYVVFELMESDLHQVIKANDDLTPE 191
            |.:...|.||||.:|....|.::::|:.|:...|..:.||||:|..|||:||::::| ...|:.:
  Fly    74 HQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLK-TQRLSND 137

plant   192 HHQFFLYQLLRGLKYVHAANVFHRDLKPKNILANADCKLKICDFGLARVSFNDAPTAIFWTDYVA 256
            |..:||||:||||||:|:|||.||||||.|:|.|..|.||||||||||::..:.....|.|:|||
  Fly   138 HICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVA 202

plant   257 TRWYRAPELCGSFFSK-YTPAIDIWSVGCIFAEMLLGKPLFPGKNVVHQLDIMTDFLGTPPPEAI 320
            ||||||||:  ...|| ||.:|||||||||.||||..:|:||||:.:.||:.:...||:|..:.:
  Fly   203 TRWYRAPEI--MLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDL 265

plant   321 SKIRNDKARRYLGNMRKKQPVPFSKKFPKADPSALRLLERLIAFDPKDRPSAEEALADPYFNGLS 385
            ..|.|:|||.||.::..|..||::|.||.||..||.||.:::.|:|..|...|||||.||.    
  Fly   266 ECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYL---- 326

plant   386 SKVREPSTQPISKLEF--EFERKKLTKDDIRELIYREILEY 424
            .:..:|..:|::::.|  ..|...:::|.::.||:.|.|::
  Fly   327 EQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPK15NP_565070.2 STKc_TDY_MAPK 89..426 CDD:143364 159/348 (46%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 155/341 (45%)
S_TKc 38..326 CDD:214567 144/291 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.