DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G71980 and DMA2

DIOPT Version :9

Sequence 1:NP_177343.2 Gene:AT1G71980 / 843529 AraportID:AT1G71980 Length:448 Species:Arabidopsis thaliana
Sequence 2:NP_014283.3 Gene:DMA2 / 855607 SGDID:S000005060 Length:522 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:48/192 - (25%)
Similarity:75/192 - (39%) Gaps:50/192 - (26%)


- Green bases have known domain annotations that are detailed below.


plant   285 PASESTPLLSSAASSFTSSSLHSSVRSSALLIGPSLGSLPTSISFSPAYASSSYIRQSFQSSSNR 349
            |...:||..::..||.||:|      |||     |..:..:|...:|...:|.       :.||.
Yeast     4 PIPANTPAPTAPTSSMTSNS------SSA-----SNANTTSSSGINPRNRASG-------TPSNE 50

plant   350 RSPP---ISVSRSSVDLRQ--QAASPSPSPSQRSY-----ISHMA--------SPQS----LGYP 392
            |:.|   ||...::..:||  |.||.|.:|.||.:     .|||:        :||.    |.:|
Yeast    51 RARPASGISSFLNTFGIRQNSQTASSSAAPDQRLFGTTPSNSHMSVAMESIDTAPQQQEPRLHHP 115

plant   393 TISPFNTR------YMSPYRPS---PSNASPAMAGSSNYPLNPL-RYSESAGTFSPYASANS 444
            ...|.:.:      |..|...|   |:......:.:.|:..|.: ...||.....|..:.|:
Yeast   116 IQMPLSAQFHVHRNYQLPISISLTAPTTTDHQQSSAHNFEGNNVGNVQESLNQRQPNGTNNT 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G71980NP_177343.2 PA_C_RZF_like 11..161 CDD:239038
zf-RING_2 230..274 CDD:290367
DMA2NP_014283.3 FHA 228..417 CDD:224630
RING-H2_Dmap_like 431..477 CDD:319372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.