DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G71980 and rnf13

DIOPT Version :9

Sequence 1:NP_177343.2 Gene:AT1G71980 / 843529 AraportID:AT1G71980 Length:448 Species:Arabidopsis thaliana
Sequence 2:NP_001008015.1 Gene:rnf13 / 493377 XenbaseID:XB-GENE-954771 Length:383 Species:Xenopus tropicalis


Alignment Length:338 Identity:112/338 - (33%)
Similarity:161/338 - (47%) Gaps:73/338 - (21%)


- Green bases have known domain annotations that are detailed below.


plant     8 LLYVCTVSCLASSKVILMR--------NNITLSFDDIEANFAPSVKGTGEIGVVYVAEPLDACQN 64
            ||..|  ||||...::.::        :|::.:|||:.|.|...:...|..|.:..|:|.:|||.
 Frog    17 LLAFC--SCLAVIHLVPVQADVAAYTADNVSRTFDDLPARFGYRLPSDGLKGYIVTAKPENACQP 79

plant    65 LMNKPEQSSNETSPF-VLIVRGGCSFEEKVRKAQRAGFKAAIIYDNEDRGTLIAMAGNS----GG 124
            :...|....|.:|.| |||.|..|:|:.||..||:||||||::| |.|...||:|..|.    ..
 Frog    80 ISPPPLLRDNTSSVFIVLIKRLECNFDLKVLNAQKAGFKAAVVY-NVDSDDLISMGSNDVDILKQ 143

plant   125 IRIHAVFVTKETGEVLK-----EYAGF----PD----TKVWLIPSFENSAWSIMAVSFISLLAMS 176
            |.|.:||:.:.:...||     |..|:    ||    .:.:|||             |:.::.:.
 Frog   144 IDIPSVFIGESSARFLKEEFSWEKGGYIVLVPDLTLPLEYYLIP-------------FLIIVGIC 195

plant   177 AVLATCFFVR-----RHRIRRRTSRSSRVREFHGMSRRLVKAMPSLIFSSFHEDNTTAFTCAICL 236
            .||...|.:.     |||.||...|..:           :|.:|...|....|.:    .||:||
 Frog   196 LVLIVIFMITKFVQDRHRARRNRLRKDQ-----------LKKLPIHKFKKGDEYD----VCAVCL 245

plant   237 EDYTVGDKLRLLPCCHKFHAACVDSWLTSWRTFCPVCKR-----------DARTSTGEPPASEST 290
            ::|..|||||:|||.|.:|..|||.|||..:..|||||:           |:.:|..:...||:|
 Frog   246 DEYEEGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSESDSDSSQEDNEVSENT 310

plant   291 PLLSSAASSFTSS 303
            |||...||:.|.|
 Frog   311 PLLRPMASASTQS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G71980NP_177343.2 PA_C_RZF_like 11..161 CDD:239038 58/175 (33%)
zf-RING_2 230..274 CDD:290367 24/43 (56%)
rnf13NP_001008015.1 PA_C_RZF_like 24..181 CDD:239038 52/157 (33%)
RING_Ubox 239..284 CDD:388418 25/48 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I4019
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I2056
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - mtm3637
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.