DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G71980 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_177343.2 Gene:AT1G71980 / 843529 AraportID:AT1G71980 Length:448 Species:Arabidopsis thaliana
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:275 Identity:70/275 - (25%)
Similarity:110/275 - (40%) Gaps:81/275 - (29%)


- Green bases have known domain annotations that are detailed below.


plant    70 EQSSNETSP-------------------FVLIVRGGCSFEEKVRKAQRAGFKAAIIYDNEDRGT- 114
            ||.|..:.|                   |:|:.||.|::.:|..:|||.|||..|:.||....: 
pombe   116 EQKSYSSKPSARVQKDDGGESKDEAILDFLLVQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSF 180

plant   115 -LIAMAG----NSGGIRIHAVFVTKET-----GEVLKEYAGFPDTKVWLIP-SFENSAWSIM--- 165
             |..|..    :...:.|.::||:..:     .::|..|.  ...|::..| ...:..|..:   
pombe   181 RLHYMVAPDKVDESKVHIPSLFVSTSSYNLLWSDLLHSYR--QPLKLYAKPEELGDMFWPFLLCF 243

plant   166 AVSFISLLAMSAVLATCFFVRRHRIRRRTSRSSRVREFHGMSRRLVKAMPSLIFS--SFHEDN-- 226
            :.|.|.|:.:.| ||...|:|.:|.:.:|             ||.::.:||...|  .|:.:.  
pombe   244 SPSIIMLITVQA-LAIRKFIRTYRTKSKT-------------RRFIEDLPSRTISREGFYSEEEE 294

plant   227 ---------------------TTAFTCAICLEDYTVGDKLRLLPCCHKFHAACVDSWLTSWRTFC 270
                                 |....|.||||.:|.|||:..|||.|:||..|:..|:..:|..|
pombe   295 IENSTQNGELVPLMDESTRRATFGVECVICLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHAC 359

plant   271 PVCKRDARTSTGEPP 285
            |.|      :|..||
pombe   360 PTC------NTEVPP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G71980NP_177343.2 PA_C_RZF_like 11..161 CDD:239038 28/121 (23%)
zf-RING_2 230..274 CDD:290367 20/43 (47%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 70/275 (25%)
Peptidases_S8_S53 <144..211 CDD:299169 20/66 (30%)
zf-RING_2 320..362 CDD:290367 20/41 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3131
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2016
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm8357
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.