| Sequence 1: | NP_115749.2 | Gene: | PCGF5 / 84333 | HGNCID: | 28264 | Length: | 256 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523725.2 | Gene: | Psc / 36431 | FlyBaseID: | FBgn0005624 | Length: | 1601 | Species: | Drosophila melanogaster |
| Alignment Length: | 47 | Identity: | 11/47 - (23%) |
|---|---|---|---|
| Similarity: | 17/47 - (36%) | Gaps: | 15/47 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Human 73 VYVRLALSSDAYGGRFFQLVLCGHKLEPLVLVQLSERYEQMEFLGRH 119 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PCGF5 | NP_115749.2 | RING-HC_PCGF5 | 6..100 | CDD:438395 | 6/26 (23%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 94..133 | 6/26 (23%) | |||
| RAWUL_PCGF5 | 136..256 | CDD:340604 | |||
| Psc | NP_523725.2 | RING_Ubox | 254..341 | CDD:473075 | |
| RAWUL_PCGF2_like | 371..465 | CDD:340602 | |||
| PHA03247 | <1160..1381 | CDD:223021 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||