DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACBD6 and Acbp5

DIOPT Version :10

Sequence 1:NP_115736.1 Gene:ACBD6 / 84320 HGNCID:23339 Length:282 Species:Homo sapiens
Sequence 2:NP_648255.1 Gene:Acbp5 / 39005 FlyBaseID:FBgn0035926 Length:82 Species:Drosophila melanogaster


Alignment Length:61 Identity:22/61 - (36%)
Similarity:32/61 - (52%) Gaps:2/61 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    63 EQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDP 123
            |..|..|..|||.:.|:.|..||:  |.||..|::||.:....|...|...|:|:.:|.:|
  Fly    21 EVYLEFYGLYKQFQEGDINIEKPA--DAEGAAKYDAWLSRKGLSVDDAKAAYVALYEKYNP 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACBD6NP_115736.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
ACBP 43..118 CDD:459982 20/54 (37%)
ANKYR <166..>261 CDD:440430
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Acbp5NP_648255.1 ACBP 2..76 CDD:469667 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.