DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACBD6 and anox

DIOPT Version :9

Sequence 1:NP_115736.1 Gene:ACBD6 / 84320 HGNCID:23339 Length:282 Species:Homo sapiens
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:239 Identity:80/239 - (33%)
Similarity:121/239 - (50%) Gaps:12/239 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    38 ETSCLAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKAL 102
            :|..:.|||..|..|:...........||..|..|||...|.|....|.....:.|.||:||:.|
  Fly     5 DTDTVDELFHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNL 69

Human   103 GDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVISSLYHEETIREEDKNIFDYCR 167
            |..|.|.|.|.|:..:::|.|.|.        ...|.|:....|.|:..|:...:.:|.:||:.:
  Fly    70 GTMSQSAARQAYVQKLQELQPNWR--------SRRNPGWVVHSIESVPLEDQRLDSEKTLFDHVK 126

Human   168 ENNIDHITKAIKSKNVDVNVK-DEEGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHY 231
            |||:|.:.:.::..::   || ||.|.||:|||.||...|::..|::..|.:|.:|.|.||.|||
  Fly   127 ENNLDRLRELLQPSDL---VKLDEHGMALIHWATDRNAVEIIQFLVRSGASVNQRDAEQQTPLHY 188

Human   232 ASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQ 275
            |::|..|:.::.||:..|...|||.||....:|...:.:..|||
  Fly   189 AASCGHLEALQCLLELHASLELRDSDGQTCYDVADDEQICQVLQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACBD6NP_115736.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
ACBP 44..123 CDD:307165 27/78 (35%)
Acyl-CoA binding. /evidence=ECO:0000250 69..73 1/3 (33%)
ANK 165..261 CDD:238125 38/96 (40%)
ANK repeat 191..222 CDD:293786 12/30 (40%)
ANK 1 191..220 11/28 (39%)
ANK repeat 224..255 CDD:293786 13/30 (43%)
ANK 2 224..253 12/28 (43%)
anoxNP_001027085.1 ACBP 10..90 CDD:279259 27/79 (34%)
ANK 125..231 CDD:238125 39/108 (36%)
Ank_2 125..212 CDD:289560 34/89 (38%)
ANK repeat 148..179 CDD:293786 12/30 (40%)
ANK repeat 181..212 CDD:293786 13/30 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12465
Inparanoid 1 1.050 140 1.000 Inparanoid score I4504
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54934
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005754
OrthoInspector 1 1.000 - - oto88878
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5885
SonicParanoid 1 1.000 - - X1917
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.960

Return to query results.
Submit another query.