DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACBD6 and CG8814

DIOPT Version :10

Sequence 1:NP_115736.1 Gene:ACBD6 / 84320 HGNCID:23339 Length:282 Species:Homo sapiens
Sequence 2:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster


Alignment Length:87 Identity:25/87 - (28%)
Similarity:43/87 - (49%) Gaps:5/87 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    40 SCLAELFEKAAAHLQGLIQ----VASREQLLYLYARYKQVKVGNCNT-PKPSFFDFEGKQKWEAW 99
            :.:.|.|:.|...::||.:    ..|...:|..|..:||...|..:. .||.|:|..||.||:||
  Fly     2 AAIEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAW 66

Human   100 KALGDSSPSQAMQEYIAVVKKL 121
            ......:..:|||.|:..::::
  Fly    67 NDNRHLTKEEAMQRYVESLQEI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACBD6NP_115736.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
ACBP 43..118 CDD:459982 25/79 (32%)
ANKYR <166..>261 CDD:440430
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
CG8814NP_608729.1 ACBP 5..83 CDD:459982 25/77 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.