DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VPS25 and Vps25

DIOPT Version :9

Sequence 1:NP_115729.1 Gene:VPS25 / 84313 HGNCID:28122 Length:176 Species:Homo sapiens
Sequence 2:NP_001166922.1 Gene:Vps25 / 681059 RGDID:1584685 Length:176 Species:Rattus norvegicus


Alignment Length:176 Identity:173/176 - (98%)
Similarity:176/176 - (100%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKL 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKL 65

Human    66 QRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYEL 130
            |||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||
  Rat    66 QRKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYEL 130

Human   131 TNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176
            |:|||||:||||||||||||||||||||||||||||||||||||||
  Rat   131 TSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VPS25NP_115729.1 ESCRT-II 10..139 CDD:399106 126/128 (98%)
Vps25NP_001166922.1 ESCRT-II 10..139 CDD:399106 126/128 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83685645
Domainoid 1 1.000 279 1.000 Domainoid score I16828
eggNOG 1 0.900 - - E1_KOG4068
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6303
Inparanoid 1 1.050 359 1.000 Inparanoid score I13813
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG54593
OrthoDB 1 1.010 - - D1094121at2759
OrthoFinder 1 1.000 - - FOG0004660
OrthoInspector 1 1.000 - - oto136090
orthoMCL 1 0.900 - - OOG6_103180
Panther 1 1.100 - - LDO PTHR13149
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3846
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1717.310

Return to query results.
Submit another query.