DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VPS25 and vps25

DIOPT Version :9

Sequence 1:NP_115729.1 Gene:VPS25 / 84313 HGNCID:28122 Length:176 Species:Homo sapiens
Sequence 2:NP_001082831.2 Gene:vps25 / 407684 ZFINID:ZDB-GENE-050506-30 Length:174 Species:Danio rerio


Alignment Length:174 Identity:136/174 - (78%)
Similarity:154/174 - (88%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     3 MSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQR 67
            |||||||||.|||||||||||||||||||||||||||:||..|..::.|:||||||:|||.|::|
Zfish     1 MSFEWPWQYNFPPFFTLQPNVDTRQKQLAAWCSLVLSYCRHRKLYTLDVLEAQESPVFNNKKIER 65

Human    68 KLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTN 132
            ||.||:||:|.||||||||||||||:||..|||||||||||||||||||::|..|||||||||.|
Zfish    66 KLSVEAIQVVFEELRKKGNLEWLDKNKSRCLIMWRRPEEWGKLIYQWVSKNGMVNSVFTLYELAN 130

Human   133 GEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176
            |:|||.||||||::..|||:|||||.:.|||||||.||:|||||
Zfish   131 GDDTEKEEFHGLEDWMLLRSLQALQTDGKAEIITVDDGKGVKFF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VPS25NP_115729.1 ESCRT-II 10..139 CDD:399106 101/128 (79%)
vps25NP_001082831.2 ESCRT-II 8..143 CDD:283517 106/134 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194332155
Domainoid 1 1.000 231 1.000 Domainoid score I10699
eggNOG 1 0.900 - - E1_KOG4068
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6303
Inparanoid 1 1.050 289 1.000 Inparanoid score I9697
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG54593
OrthoDB 1 1.010 - - D1094121at2759
OrthoFinder 1 1.000 - - FOG0004660
OrthoInspector 1 1.000 - - oto48683
orthoMCL 1 0.900 - - OOG6_103180
Panther 1 1.100 - - LDO PTHR13149
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1645
SonicParanoid 1 1.000 - - X3846
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
1818.340

Return to query results.
Submit another query.