DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VPS25 and Vps25

DIOPT Version :9

Sequence 1:NP_115729.1 Gene:VPS25 / 84313 HGNCID:28122 Length:176 Species:Homo sapiens
Sequence 2:NP_610398.1 Gene:Vps25 / 35847 FlyBaseID:FBgn0022027 Length:174 Species:Drosophila melanogaster


Alignment Length:172 Identity:74/172 - (43%)
Similarity:115/172 - (66%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     5 FEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKL 69
            |:|||:|.|||||||||:.:|||:||..|..|.|.:.|...:.::::.: |.||||:|..|:|:|
  Fly     4 FQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGD-QNSPLFHNEALKRRL 67

Human    70 PVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGE 134
            ..|.:..:|.||.:.|:...|||.:..:.:.|...||:|.::|.||..:||.|::.||||:.:||
  Fly    68 SPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLYEIASGE 132

Human   135 DTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176
            :|...:|:|:|||.||.||:.|:::.:.|:|.:....|||||
  Fly   133 NTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VPS25NP_115729.1 ESCRT-II 10..139 CDD:399106 53/128 (41%)
Vps25NP_610398.1 ESCRT-II 9..143 CDD:283517 55/134 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148275
Domainoid 1 1.000 123 1.000 Domainoid score I5632
eggNOG 1 0.900 - - E1_KOG4068
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6303
Inparanoid 1 1.050 164 1.000 Inparanoid score I4198
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54593
OrthoDB 1 1.010 - - D1094121at2759
OrthoFinder 1 1.000 - - FOG0004660
OrthoInspector 1 1.000 - - oto89495
orthoMCL 1 0.900 - - OOG6_103180
Panther 1 1.100 - - LDO PTHR13149
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1645
SonicParanoid 1 1.000 - - X3846
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.