DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VPS25 and Vps25

DIOPT Version :9

Sequence 1:NP_115729.1 Gene:VPS25 / 84313 HGNCID:28122 Length:176 Species:Homo sapiens
Sequence 2:NP_001271340.1 Gene:Vps25 / 28084 MGIID:106354 Length:184 Species:Mus musculus


Alignment Length:184 Identity:174/184 - (94%)
Similarity:176/184 - (95%) Gaps:8/184 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKL 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKL 65

Human    66 QR--------KLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNN 122
            ||        |||||||||||||||||||||||||:|||||||||||||||||||||||||||||
Mouse    66 QRHSLNLKPGKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNN 130

Human   123 SVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176
            |||||||||:||||||||||||||||||||||||||||||||||||||||||||
Mouse   131 SVFTLYELTSGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VPS25NP_115729.1 ESCRT-II 10..139 CDD:399106 126/136 (93%)
Vps25NP_001271340.1 ESCRT-II 10..153 CDD:283517 132/142 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83961852
Domainoid 1 1.000 280 1.000 Domainoid score I17578
eggNOG 1 0.900 - - E1_KOG4068
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6303
Inparanoid 1 1.050 360 1.000 Inparanoid score I14281
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG54593
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004660
OrthoInspector 1 1.000 - - oto119795
orthoMCL 1 0.900 - - OOG6_103180
Panther 1 1.100 - - LDO PTHR13149
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1645
SonicParanoid 1 1.000 - - X3846
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.290

Return to query results.
Submit another query.