DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP10 and Decay

DIOPT Version :9

Sequence 1:NP_116759.2 Gene:CASP10 / 843 HGNCID:1500 Length:522 Species:Homo sapiens
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:276 Identity:89/276 - (32%)
Similarity:135/276 - (48%) Gaps:30/276 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   261 ANTLNSETSTKRAAVYR-------MNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLG 318
            |:|..||...||..:.|       .|....|:.:|:|:......|.|.||.:|.:.:....|..|
  Fly    26 AHTPTSELDLKRIIISRPTNEDTYENCARAGIALILNHKDVKGQKQRVGTERDRDDMEATLQGFG 90

Human   319 FTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTA 383
            |.|...:::|..|:...| |:.....|:..||||..:::||..|.||:.|.: .|:..:.:.|..
  Fly    91 FDVRTFDDLTFSEINDTL-KEVAREDHSQNDCFVLAVMSHGTEGKVYAKDMS-YPVERLWNPFLG 153

Human   384 LQCPRLAEKPKLFFIQACQGEEIQPSVSIEADAL-------NPEQAPTSLQDSIPAEADFLLGLA 441
            ..|..|..||||||||||:|..::.:|...:.|:       .|..|...:..:||:.||.|:..:
  Fly   154 DNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYS 218

Human   442 TVPGYVSFRHVEEGSWYIQSLCNHL------KKLVPRHEDILSILTAVNDDVSRRVDKQGTK--- 497
            |...:.|||:|::|||:|||||..|      :...|...::|.:|||||..|:... :..||   
  Fly   219 TFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEY-QSNTKNEA 282

Human   498 ----KQMPQPAFTLRK 509
                |:||....||.|
  Fly   283 LNQMKEMPNFMSTLTK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP10NP_116759.2 DD 18..99 CDD:326335
DED_Caspase_10_r2 112..190 CDD:260074
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..269 4/7 (57%)
CASc 276..514 CDD:214521 83/261 (32%)
DecayNP_477462.1 CASc 54..302 CDD:237997 81/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.