DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK24 and hpo

DIOPT Version :9

Sequence 1:XP_016876283.1 Gene:STK24 / 8428 HGNCID:11403 Length:517 Species:Homo sapiens
Sequence 2:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster


Alignment Length:421 Identity:173/421 - (41%)
Similarity:237/421 - (56%) Gaps:67/421 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   100 KNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCD 164
            ::|...||::|..:.|:|:||:|.|:|.:...:..:||||::.:   |.::.:|.:||:::.|||
  Fly    32 ESLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPV---ESDLHEIIKEISIMQQCD 93

Human   165 SPYVTKYYGSYLKDTKLWIIMEYLGGGSALDL--LEPGPLDETQIATILREILKGLDYLHSEKKI 227
            ||||.:|||||.|...|||.|||.|.||..|:  |....|.|.:|||||.:.|:||.|||..:||
  Fly    94 SPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKI 158

Human   228 HRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLG 292
            ||||||||:||:..|..||||||||||||||..||||.:|||||||||||::..||..|||||||
  Fly   159 HRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLG 223

Human   293 ITAIELARGEPPHSELHPMKVLFLIPKNNPPTLE--GNYSKPLKEFVEACLNKEPSFRPTAKELL 355
            |||:|:|.|:||:.|:|||:.:|:||:..||:..  ..:|....:||..||.|||..|.||.|||
  Fly   224 ITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELL 288

Human   356 KHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDP 420
            :|:|| ||||..|.|..::                 |::.|..:.|.:..|..|    .:.....
  Fly   289 EHEFI-RNAKHRSILKPML-----------------EETCAIREQQRANRSFGG----VLAASQA 331

Human   421 KNL---ENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAI 482
            |:|   |||..|          .|....|.:...|::...|.|.::.|                 
  Fly   332 KSLATQENGMQQ----------HITDNAFMEDPGTLVPEKFGEYQQSS----------------- 369

Human   483 YLAEEACPGISDTMVAQLVQRLQRYSLSGGG 513
              |.:|      ||:|...|.:...:|..||
  Fly   370 --ASDA------TMIAHAEQGVDEGTLGPGG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK24XP_016876283.1 None
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 138/257 (54%)
S_TKc 42..293 CDD:214567 136/253 (54%)
Mst1_SARAH 608..655 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D967913at2759
OrthoFinder 1 1.000 - - FOG0000324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.