DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSDL2 and ScpX

DIOPT Version :10

Sequence 1:NP_115679.2 Gene:HSDL2 / 84263 HGNCID:18572 Length:418 Species:Homo sapiens
Sequence 2:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster


Alignment Length:99 Identity:34/99 - (34%)
Similarity:57/99 - (57%) Gaps:4/99 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   323 DDVVKATQAIYLFEL-SGEDG--GTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKL 384
            |::::..:|||.|:: :|.:|  |.|.:|.|...|.:.: ..:.:.||...::.||..::.:|||
  Fly   440 DNLIEKVRAIYGFKVNNGPNGQTGFWVIDAKQGKGKIIF-NGTQKCDVTFIISDDDVFELLTGKL 503

Human   385 KPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL 418
            .|..||..||:||:|||..|:||..|......|:
  Fly   504 PPQKAFFQGKIKIQGNMGFAMKLMDLQRSAQGRI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSDL2NP_115679.2 HSDL2_SDR_c 8..248 CDD:187663
SCP2 311..414 CDD:442486 33/93 (35%)
ScpXNP_524715.2 PRK08256 5..396 CDD:181327
SCP2 428..531 CDD:460423 33/91 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.