Sequence 1: | NP_115679.2 | Gene: | HSDL2 / 84263 | HGNCID: | 18572 | Length: | 418 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651111.1 | Gene: | CG13833 / 42718 | FlyBaseID: | FBgn0039040 | Length: | 321 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 49/197 - (24%) |
---|---|---|---|
Similarity: | 88/197 - (44%) | Gaps: | 18/197 - (9%) |
- Green bases have known domain annotations that are detailed below.
Human 8 LAGCTVFITGASRGIGKAIALKAAKDGANIVIA---AKTAQPHPKLLGTIYTAAEEIEAVGGKAL 69
Human 70 PCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASK 134
Human 135 ACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEF----KGEIAVNAL 195
Human 196 WP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HSDL2 | NP_115679.2 | HSDL2_SDR_c | 8..248 | CDD:187663 | 49/197 (25%) |
SCP2 | 319..412 | CDD:376720 | |||
CG13833 | NP_651111.1 | adh_short | 53..241 | CDD:278532 | 47/194 (24%) |
NADB_Rossmann | 54..297 | CDD:304358 | 47/193 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1809 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |