DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSDL2 and CG13833

DIOPT Version :9

Sequence 1:NP_115679.2 Gene:HSDL2 / 84263 HGNCID:18572 Length:418 Species:Homo sapiens
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:197 Identity:49/197 - (24%)
Similarity:88/197 - (44%) Gaps:18/197 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     8 LAGCTVFITGASRGIGKAIALKAAKDGANIVIA---AKTAQPHPKLLGTIYTAAEEIEAVGGKAL 69
            :||....:|||..|:|:||:|:.||.|.:|.:.   ...|:...|.:..||    ::.|...|| 
  Fly    50 IAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIY----KVRAKAYKA- 109

Human    70 PCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASK 134
                :|.:...:.....|.:::.|.:.:|||||..:...|..:.....:.||:|||....:....
  Fly   110 ----NVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKL 170

Human   135 ACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEF----KGEIAVNAL 195
            ..:|.:|:.:...|:.||....:.|:.:.  ..||..|.|...::..:..|.    :.:|.|..:
  Fly   171 VFLPKMKELRKGFIVTISSLAGVFPLPYS--ATYTTTKSGALAHMRTLRMELDLENQKDIHVTTV 233

Human   196 WP 197
            .|
  Fly   234 LP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSDL2NP_115679.2 HSDL2_SDR_c 8..248 CDD:187663 49/197 (25%)
SCP2 319..412 CDD:376720
CG13833NP_651111.1 adh_short 53..241 CDD:278532 47/194 (24%)
NADB_Rossmann 54..297 CDD:304358 47/193 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.