Sequence 1: | NP_115679.2 | Gene: | HSDL2 / 84263 | HGNCID: | 18572 | Length: | 418 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649563.1 | Gene: | CG12171 / 40690 | FlyBaseID: | FBgn0037354 | Length: | 257 | Species: | Drosophila melanogaster |
Alignment Length: | 244 | Identity: | 68/244 - (27%) |
---|---|---|---|
Similarity: | 109/244 - (44%) | Gaps: | 38/244 - (15%) |
- Green bases have known domain annotations that are detailed below.
Human 13 VFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGG-KALPCIVDVR 76
Human 77 DEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLK 141
Human 142 KSKVAHILNISPPLNLNPV-WFKQHCAYTIAKYGMSMYVLGMAEEF--KGEIAVNALWPKTAI-- 201
Human 202 -----------------HTAAMDMLGGPG-IESQCRKVDIIA--DAAYS 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HSDL2 | NP_115679.2 | HSDL2_SDR_c | 8..248 | CDD:187663 | 68/244 (28%) |
SCP2 | 319..412 | CDD:376720 | |||
CG12171 | NP_649563.1 | fabG | 2..251 | CDD:235975 | 68/244 (28%) |
NADB_Rossmann | 4..254 | CDD:304358 | 68/244 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |