DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSDL2 and Dhrs4

DIOPT Version :10

Sequence 1:NP_115679.2 Gene:HSDL2 / 84263 HGNCID:18572 Length:418 Species:Homo sapiens
Sequence 2:NP_647946.1 Gene:Dhrs4 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:200 Identity:59/200 - (29%)
Similarity:102/200 - (51%) Gaps:25/200 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     7 RLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEA--VGGKAL 69
            ||||....:|.::.|||.|||.:.|:|||.:||:::..:       .:.:|..|:..  :....|
  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQK-------NVDSALAELRKLNLNVHGL 125

Human    70 PC-IVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTN-----TLDTPTKRLDLMMNVNTRG 128
            .| :.:..|.:|:   .|:.|.|||.::|||:||:    ||     .|:...|..|.:.:||.:.
  Fly   126 KCHVSEPEDRKQL---FEETISKFGKLNILVSNAA----TNPAVGGVLECDEKVWDKIFDVNVKS 183

Human   129 TYLASKACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGE-IAV 192
            :||.:|..:|.|::.|.:.|:.:|.....:.  |:...||:::|..:.......|::...| |.|
  Fly   184 SYLLAKEALPLLRQQKNSSIVFVSSIAGYDA--FELLGAYSVSKTALIGLTKAAAKDLAPEGIRV 246

Human   193 NALWP 197
            |.|.|
  Fly   247 NCLAP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSDL2NP_115679.2 HSDL2_SDR_c 8..248 CDD:187663 57/198 (29%)
SCP2 311..414 CDD:442486
Dhrs4NP_647946.1 Rossmann-fold NAD(P)(+)-binding proteins 67..317 CDD:473865 58/199 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.