DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSDL2 and CG11151

DIOPT Version :9

Sequence 1:NP_115679.2 Gene:HSDL2 / 84263 HGNCID:18572 Length:418 Species:Homo sapiens
Sequence 2:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster


Alignment Length:114 Identity:36/114 - (31%)
Similarity:61/114 - (53%) Gaps:10/114 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   311 EETFRIVKDSLSDD--VVKATQAIYLFELS--GEDGGTWFLDLKSKGGNVGYGEPSD--QADVVM 369
            :..|:.:.|.|.::  ..||...::|::::  |:....|.||.|:.   ..|..|:.  :.|..:
  Fly     6 DAVFQKIIDGLKENEAKAKAVNGVFLYKITKDGKVAKEWTLDCKNA---KAYEGPAQGIKVDTTL 67

Human   370 SMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL 418
            ::..:|.|.:..|||.|..|||.|||||.||:.|..||..|: :.:|:|
  Fly    68 TVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLL-KTDAKL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSDL2NP_115679.2 HSDL2_SDR_c 8..248 CDD:187663
SCP2 319..412 CDD:376720 33/98 (34%)
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 33/102 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.