DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SGIP1 and fcho-1

DIOPT Version :10

Sequence 1:XP_016857994.1 Gene:SGIP1 / 84251 HGNCID:25412 Length:850 Species:Homo sapiens
Sequence 2:NP_493947.1 Gene:fcho-1 / 173511 WormBaseID:WBGene00018974 Length:968 Species:Caenorhabditis elegans


Alignment Length:135 Identity:27/135 - (20%)
Similarity:45/135 - (33%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   265 GVGVKTASRWYQEGLRTLDELREQPQRLTQQQKAVLPTGLQYYQ--------DLSTPVSRAEAEA 321
            |:..:.||.:........|..|.....|..      ||.|..::        ::|..:.:...:.
 Worm    28 GIEEEVASAFVNHYYHLFDNDRSSLSSLYN------PTSLLTFEGQTIYGVDNISNKLKQLPFDQ 86

Human   322 LQQLVEAAMREILPGATVTLTGG---FRRGKLQGHDVDFLITHPEEGQEVGLLPRVMRCLQSQGL 383
            ...|:...  :..|.:.....||   |..|.:|.|..|    ||....:|.||   ..|.:.:|.
 Worm    87 CHHLISTV--DSQPSSMAGGCGGILVFVSGSIQLHGED----HPLRFSQVYLL---SICNRFEGF 142

Human   384 VLYHQ 388
            :...|
 Worm   143 IWLKQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SGIP1XP_016857994.1 SGIP1_MHD 583..849 CDD:271172
fcho-1NP_493947.1 F-BAR_FCHO 14..274 CDD:153332 27/135 (20%)
AP_MHD_Cterm 689..963 CDD:472082
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.