| Sequence 1: | XP_047305019.1 | Gene: | ATP13A4 / 84239 | HGNCID: | 25422 | Length: | 1239 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001286728.1 | Gene: | CG45063 / 19835490 | FlyBaseID: | FBgn0266433 | Length: | 252 | Species: | Drosophila melanogaster |
| Alignment Length: | 46 | Identity: | 11/46 - (23%) |
|---|---|---|---|
| Similarity: | 20/46 - (43%) | Gaps: | 14/46 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Human 11 TSTAKQKQKVT-EHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKA 55 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ATP13A4 | XP_047305019.1 | P5-ATPase | 59..184 | CDD:463565 | |
| P-type_ATPase_cation | 216..1058 | CDD:319842 | |||
| CG45063 | NP_001286728.1 | ATPase-IIC_X-K | 21..>230 | CDD:273445 | 11/46 (24%) |
| Blue background indicates that the domain is not in the aligned region. | |||||