DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPK2 and rl

DIOPT Version :9

Sequence 1:NP_564746.1 Gene:MPK2 / 842248 AraportID:AT1G59580 Length:376 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:365 Identity:174/365 - (47%)
Similarity:252/365 - (69%) Gaps:18/365 - (4%)


- Green bases have known domain annotations that are detailed below.


plant     2 ATPVDPPNG--IRNQGKHYFSMWQTLFEIDTKYVPIKPIGRGAYGVVCSSVNRESNERVAIKKIH 64
            :|.|...|.  ||.|          :||:..:|:.:..||.||||:|.|:.:..:|:||||||| 
  Fly    16 STEVPQSNAEVIRGQ----------IFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKI- 69

plant    65 NVFENRIDALRTLRELKLLRHLRHENVVALKDVMMANHKRSFKDVYLVYELMDTDLHQIIKSSQV 129
            :.||::....|||||:.:|...:|||::.::|::..:.....:|||:|..||:|||::::| :|.
  Fly    70 SPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLK-TQR 133

plant   130 LSNDHCQYFLFQLLRGLKYIHSANILHRDLKPGNLLVNANCDLKICDFGLARTSNTKGQ---FMT 191
            |||||..|||:|:|||||||||||:|||||||.|||:|..||||||||||||.::.:..   |:|
  Fly   134 LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLT 198

plant   192 EYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPVFPGTECLNQIKLIINILGSQREE 256
            |||.||||||||::|....|..|||:||||||.||:|..:|:|||...|:|:..|:.:|||...:
  Fly   199 EYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRD 263

plant   257 DLEFIDNPKAKRYIESLPYSPGISFSRLYPGANVLAIDLLQKMLVLDPSKRISVTEALQHPYMAP 321
            |||.|.|.||:.|:||||:.|.:.:::|:|.|:.||:|||.|||..:|.|||.|.|||.|||:..
  Fly   264 DLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQ 328

plant   322 LYDPSANPPAQVPIDLDVDEDEDLGAEMIRELMWKEMIHY 361
            .|||...|.|:||..::: |::|:..:.::.|:::|.:.:
  Fly   329 YYDPGDEPVAEVPFRINM-ENDDISRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPK2NP_564746.1 STKc_TEY_MAPK 26..363 CDD:143363 168/339 (50%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 168/336 (50%)
S_TKc 38..326 CDD:214567 154/289 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 317 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I618
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm2432
orthoMCL 1 0.900 - - OOG6_100339
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.