DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP9 and Strica

DIOPT Version :9

Sequence 1:XP_011540575.1 Gene:CASP9 / 842 HGNCID:1511 Length:421 Species:Homo sapiens
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:310 Identity:79/310 - (25%)
Similarity:128/310 - (41%) Gaps:65/310 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   114 EIRKPEVLRPETPRP-VDIGSGG-----FGDVGALESLRGNADLAYILS--------MEPCGHCL 164
            ::.|| :....||:| :.:||.|     ...|...:..:|....:..:|        ::| ....
  Fly   254 QVDKP-LSSTATPKPFISLGSSGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKP-ARVY 316

Human   165 IINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGD---LTAKKMVLALLELAQQDHGA 226
            |.|:..|..::  ..|.||..|.:.||..|..|...|||..|   :|.||.|..|.....:|..|
  Fly   317 IFNHERFDNKN--EFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSA 379

Human   227 LDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQ 291
            |   |:||||||.:...:......|..|.     :.:..|....   :|..||||.|:|||.|:.
  Fly   380 L---VLVILSHGTRHDQIAAKDDDYSLDD-----DVVFPILRNR---TLKDKPKLIFVQACKGDC 433

Human   292 KDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRD 356
            :..||...:..|.    ||                           |::|...|||:.||||:| 
  Fly   434 QLGGFMTDAAQPN----GS---------------------------PNEILKCYSTYEGFVSFR- 466

Human   357 PKSGSWYVETLDDIFEQWAHSEDLQSLLLRVSAAFLCKGEGRLLRGSVSS 406
            .:.|:.:::||.:...:...:.|:.::::.|......:.:.|.: .||:|
  Fly   467 TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQI-PSVTS 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP9XP_011540575.1 CARD_CASP9 17..90 CDD:176740
CASc 152..397 CDD:237997 65/255 (25%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 68/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6822
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.