DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAMMA-H2AX and His2A:CG33829

DIOPT Version :9

Sequence 1:NP_175868.1 Gene:GAMMA-H2AX / 841910 AraportID:AT1G54690 Length:142 Species:Arabidopsis thaliana
Sequence 2:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster


Alignment Length:124 Identity:93/124 - (75%)
Similarity:103/124 - (83%) Gaps:3/124 - (2%)


- Green bases have known domain annotations that are detailed below.


plant     7 SGTTKGGRGKPKATKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVL 71
            ||..|||:.|.||.   |||::||||||||||.|.|:.|.|||||||||||||:||:||||||||
  Fly     2 SGRGKGGKVKGKAK---SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63

plant    72 ELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLPSKVGK 130
            |||||||||||||||:|||:|||:||||||:|||..||||.|||||||...|||.|..|
  Fly    64 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAMMA-H2AXNP_175868.1 PLN00156 4..142 CDD:215080 93/124 (75%)
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 85/107 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 132 1.000 Domainoid score I1660
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I1426
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm981
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X55
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.