DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLITRK6 and kek4

DIOPT Version :10

Sequence 1:NP_115605.2 Gene:SLITRK6 / 84189 HGNCID:23503 Length:841 Species:Homo sapiens
Sequence 2:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster


Alignment Length:597 Identity:134/597 - (22%)
Similarity:209/597 - (35%) Gaps:199/597 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   334 NCKVLSPSGLLIHCQERNIESLSDLRPPPQNPRKLILAGNIIHSLMKSDLVEYFT--LEMLHLGN 396
            ||          ||:..:.:..:|.|                 :|..|.:.||.:  :::|.|.:
  Fly    44 NC----------HCKWNSGKKTADCR-----------------NLSLSGVPEYLSPEVQVLDLSH 81

Human   397 NRIEVLEEGSFM--NLTRLQKLYLNGNHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMP 459
            |.|..|||.:|:  :|..||||.:....|..|::..|..|..|..|.|..|.:.::||..|:.:.
  Fly    82 NHIFYLEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLS 146

Human   460 KLKVLYLNNNLLQVLPPHIFS------------------------GVP-LTKVNLKTNQFTHLPV 499
            |::.::||.||||.|...:|.                        ||| |:::.|..|:.|.|.|
  Fly   147 KVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRV 211

Human   500 SNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDILCTSP----GHL---DKKEL 557
            .: ..||..||.:.|.:|||:|:|||...:.::  :..|..|....|..|    |.|   |:.|.
  Fly   212 ES-FQDLTKLTALSLVENPWNCTCDLQMFRDFV--IGMNLYTPPTSCHYPLQLRGRLWIEDQPEA 273

Human   558 KALNSEILCPGLVNNPSMPTQTSYLMVT-------TPATT-----TNTA---------------- 594
            .|...:|:.|.|    |....||...||       :|.|.     ||..                
  Fly   274 FACKPKIVYPTL----STSINTSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVKSLQKQRI 334

Human   595 -----------------DTILRSLT----------------------DAVPLSVLI--------- 611
                             |..:..||                      |:|.:||::         
  Fly   335 YIELLREDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISVVVQKDMERISL 399

Human   612 -------------LGLLIMFI--TIVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSMY 661
                         :|.|.|.|  ::|.|      |:..|.:::...|....    .|..|.....
  Fly   400 IDSNFFAIVCLIAMGFLSMSILFSLVTC------LIFKRFKQFHPGQHTYL----QPTSLPVQSP 454

Human   662 GHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQEN 726
            |.:.....:...|..:.|..:|...:.....||.....|.:....|   ||:..|.:       |
  Fly   455 GSEEATAISALSSGVIRESKIVLDPLSAINEPSNKNYTLFKTSNSN---GSEYMHTR-------N 509

Human   727 HSPL-TGSNMKYKTTNQSTEFLSFQDASSLYRNI--------------LEKERELQQLGITEYLR 776
            :..: ..||...:..:...|.:|.:: ..||.||              |:|:.....|..|...|
  Fly   510 YKDVRLNSNTYTENLDNQAESISSRN-RELYSNIAGDREKEELKQKDELDKDSRQSSLQSTGCSR 573

Human   777 K--NIAQLQPDM 786
            |  .|.:||||:
  Fly   574 KKGQIDELQPDL 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLITRK6NP_115605.2 LRR <68..>213 CDD:443914
leucine-rich repeat 69..89 CDD:275380
LRR 1 89..110
leucine-rich repeat 94..113 CDD:275380
LRR 2 113..134
leucine-rich repeat 114..137 CDD:275380
LRR 3 137..158
leucine-rich repeat 138..161 CDD:275380
LRR 4 161..182
leucine-rich repeat 162..177 CDD:275380
LRR 5 184..205
leucine-rich repeat 185..260 CDD:275380
LRRCT 218..268 CDD:214507
leucine-rich repeat 261..412 CDD:275380 19/81 (23%)
LRR <363..>517 CDD:443914 51/182 (28%)
LRR 6 364..385 2/20 (10%)
leucine-rich repeat 366..388 CDD:275380 4/21 (19%)
LRR 7 388..409 8/24 (33%)
LRR 8 412..433 7/20 (35%)
leucine-rich repeat 413..436 CDD:275380 8/22 (36%)
LRR 9 436..457 7/20 (35%)
leucine-rich repeat 437..460 CDD:275380 7/22 (32%)
LRR 10 460..481 9/44 (20%)
leucine-rich repeat 461..482 CDD:275380 8/44 (18%)
LRR 11 483..504 7/21 (33%)
LRRCT 517..567 CDD:214507 17/56 (30%)
kek4NP_609615.2 LRR 59..>228 CDD:443914 52/186 (28%)
leucine-rich repeat 75..99 CDD:275380 9/23 (39%)
LRR_8 98..158 CDD:404697 19/59 (32%)
leucine-rich repeat 100..123 CDD:275380 8/22 (36%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
leucine-rich repeat 172..195 CDD:275380 2/22 (9%)
leucine-rich repeat 196..219 CDD:275380 8/23 (35%)
LRRCT 228..277 CDD:214507 16/50 (32%)
IG_like 294..390 CDD:214653 13/95 (14%)
Ig strand B 296..300 CDD:409353 2/3 (67%)
Ig strand C 309..323 CDD:409353 2/13 (15%)
Ig strand E 356..360 CDD:409353 1/3 (33%)
Ig strand F 370..375 CDD:409353 0/4 (0%)
Ig strand G 383..386 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.