DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPK18 and rl

DIOPT Version :9

Sequence 1:NP_175756.2 Gene:MPK18 / 841786 AraportID:AT1G53510 Length:615 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:341 Identity:149/341 - (43%)
Similarity:224/341 - (65%) Gaps:15/341 - (4%)


- Green bases have known domain annotations that are detailed below.


plant    24 RYRILEVIGKGSYGVVCAAIDTHTGEKVAIKKINDVFEHISDALRILREVKLLRLLRHPDIVEIK 88
            ||..|..||:|:||:|.:|.||.|.::||||||:. |||.:...|.|||:.:|...:|.:|::|:
  Fly    37 RYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISP-FEHQTYCQRTLREITILTRFKHENIIDIR 100

plant    89 SIMLPPSKREFKDIYVVFELMESDLHQVIKANDDLTREHHQFFLYQMLRALKFMHTANVYHRDLK 153
            .|:...|..:.:|:|:|..|||:||::::| ...|:.:|..:||||:||.||::|:|||.|||||
  Fly   101 DILRVDSIDQMRDVYIVQCLMETDLYKLLK-TQRLSNDHICYFLYQILRGLKYIHSANVLHRDLK 164

plant   154 PKNILANANCKLKVCDFGLARVAFNDTPTTVFWTDYVATRWYRAPELCGSFFSK-YTPAIDVWSI 217
            |.|:|.|..|.||:|||||||:|..:...|.|.|:|||||||||||:  ...|| ||.:||:||:
  Fly   165 PSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEI--MLNSKGYTKSIDIWSV 227

plant   218 GCIFAEVLTGKPLFPGKSVVHQLELITDLLGTPKSETISGVRNDKARKYLTEMRKKNPVTFSQKF 282
            |||.||:|:.:|:||||..:.||..|..:||:|..:.:..:.|:|||.||..:..|..|.:::.|
  Fly   228 GCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLF 292

plant   283 SKADPLALRLLQRLLAFDPKDRPTPAEALADPYFKGLSKIER--EPSSQQISKMEF--EFERRRL 343
            ..||.|||.||.::|.|:|..|....||||.||      :|:  :|..:.::::.|  ..|...:
  Fly   293 PNADALALDLLGKMLTFNPHKRIPVEEALAHPY------LEQYYDPGDEPVAEVPFRINMENDDI 351

plant   344 TKDDIRELIYREILEY 359
            ::|.::.||:.|.|::
  Fly   352 SRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPK18NP_175756.2 STKc_TDY_MAPK 24..361 CDD:143364 149/341 (44%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 148/338 (44%)
S_TKc 38..326 CDD:214567 139/297 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.